Recombinant Human CD10 Protein

Beta LifeScience SKU/CAT #: BLA-10806P

Recombinant Human CD10 Protein

Beta LifeScience SKU/CAT #: BLA-10806P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P08473
Synonym Atriopeptidase CALLA CD10 CD10 antigen Common acute lymphocytic leukemia antigen DKFZp686O16152 EC 3.4.24.11 Enkephalinase EPN Membrane metallo endopeptidase Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase) Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10) Membrane metallo endopeptidase variant 1 Membrane metallo endopeptidase variant 2 Membrane metalloendopeptidase Membrane metalloendopeptidase neutral endopeptidase enkephalinase Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10 Membrane metalloendopeptidase variant 1 Membrane metalloendopeptidase variant 2 MGC126681 MGC126707 MME NEP NEP_HUMAN Neprilysin neprilysin-390 neprilysin-411 Neutral endopeptidase Neutral endopeptidase 24.11 Neutral endopeptidase, membrane-associated SFE Skin fibroblast elastase
Description Recombinant Human CD10 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence DDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSS RYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSR GGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLIN LFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV ARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNK MTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYL TKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTT SETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFI QTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNY KEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQ IVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGD LVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADN GGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEY AVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Molecular Weight 85 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity 1140 pmol/min/µg (9 ng NEP were used to cleave 10µM Mca-RPPGFSAFK(Dnp)-OH (Fluorogenic Substrate) at 37°C in 50 mM TRIS, pH 9.0).
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF) and brain natriuretic factor (BNP(1-32)). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
Subcellular Location Cell membrane; Single-pass type II membrane protein.
Protein Families Peptidase M13 family
Database References
Associated Diseases Charcot-Marie-Tooth disease 2T (CMT2T); Spinocerebellar ataxia 43 (SCA43)

Gene Functions References

  1. showed CD10 positivity in fibroblast-like stromal cells and fibrous material PMID: 29791034
  2. these data indicated under cigarette smoke condensate treatment; losing of membrane p120ctn could upregulate surface NEP protein level and thus facilitate BEAS-2B cell migration. PMID: 30249887
  3. High expression of CD10 is associated with lymph node invasion in colorectal cancer. PMID: 29653092
  4. We observed an increase of VCAM-1 urine levels in diabetic nephropathy-basal patients compared to diabetic controls and an increase of urinary neprilysin in DN-treated patients with persistent albuminuria PMID: 29854824
  5. Degradation of tropoelastin and skin elastin by neprilysin PMID: 29196110
  6. Xanthorrhizol (Xan) reduced 4-hydroxynonenal (HNE) levels on NEP proteins and preserved enzymatic activities of neprilysin (NEP) in HNE- or oligomeric Abeta42-treated cells. Xan reduced Abeta42 accumulation and protected neurones against oligomeric Abeta42-induced neurotoxicity through preservation of NEP activities PMID: 29330223
  7. These findings support the role of the stromal CD10 expression in breast cancer progression and dissemination, and suggest a relationship with cancer stem cells. PMID: 29306324
  8. Aberrant CD10 and BCL6 expression defines a subset of MCLs with higher mean Ki-67 index and higher prevalence of MUM1 expression PMID: 28628241
  9. Our study firstly confirmed the association of MME miRNA binding site polymorphism with the risk of LOAD. However, the association results warrant further validation. PMID: 28294061
  10. the Ras signaling pathway is involved in HIV-1 Tat-induced changes in ZO-1 and NEP. PMID: 28553432
  11. In this meta-analysis of the Han Chinese population, neprilysin confers genetic susceptibility to Alzheimer's disease in Han Chinese populations. PMID: 26362309
  12. High CD10 expression is associated with lymphoma in Waldeyer ring. PMID: 27616053
  13. Rare Variants in MME, Encoding Metalloprotease Neprilysin, Are Linked to Late-Onset Autosomal-Dominant Axonal Polyneuropathies PMID: 27588448
  14. CD10 down expression in follicular lymphoma correlates with gastrointestinal lesion involving the stomach and large intestine PMID: 27513891
  15. High CD10 expression is associated with Basal cell carcinoma of the skin. PMID: 27039776
  16. the dynamic behavior of human NEP and NEP2 proteins was monitored by conducting molecular dynamics (MD) simulations. PMID: 26846903
  17. This study reveals some unusual findings in otherwise classical disease entity, like absence of palpable spleen, presence of lymphadenopathy, normal or elevated leukocyte counts, expression of CD10, which at times could be diagnostically challenging. PMID: 26609034
  18. Case Report: endometrial mixed carcinoma with the neuroendocrine component expressing CD10 that showed a long survival. PMID: 26830028
  19. CD10 and Bcl2 expression in tumor cells could give convincing diagnostic value to distinguish squamous cell carcinoma from seborrheic keratosis PMID: 26573127
  20. The peptide qf-Abeta(12-18)C (sequence VHHQKLVC) was cleaved by multiple Abeta-degrading enzymes, including NEP, ACE, and ECE-1, whereas the redesigned peptide qf-Abeta(12-16)AAC (sequence VHHQKAAC) was sensitive to NEP and ACE only. PMID: 27096746
  21. Loss-of-function MME mutations are the most frequent cause of adult-onset autosomal-recessive Charcot-Marie-Tooth disease type 2 in Japan. PMID: 26991897
  22. CD10 positivity is luminal/membranous in most benign apocrine breast lesions, the staining being nonuniversal and sometimes focal; analogous staining in apocrine malignancies seems rarer in DCIS and even rarer in invasive apocrine carcinomas, but atypical cytoplasmic positivity may also occur PMID: 26562027
  23. These findings indicate that CD10 may promote tumor progression by regulating the expression profiles of genes related to cell proliferation, angiogenesis, and resistance to apoptosis. PMID: 26881775
  24. CD10 gene expression plays a role in the pathogenesis of diffuse large B-cell lymphoma. PMID: 26414904
  25. High tumoral CD10 expression correlates with aggressive histology in patients with malignant pleural mesothelioma. PMID: 25608772
  26. In stage I lung adenocarcinoma, tumoral CD10 correlated with high-grade histology and was an independent predictor of recurrence in intermediate-grade tumors. PMID: 26141216
  27. CD10 strongly labelled only the gastrointestinal cells, with a well-defined apical membrane signal PMID: 24754336
  28. High CD10 expression is associated with Phylloides Tumors. PMID: 25921112
  29. The expression of neprilysin is increased in glioma cells following 5-HT2C activation. PMID: 25452160
  30. CD10 expression is related to a distinct gene expression signature in mantle cell lymphoma cases, but is without clinical or biological implications. PMID: 26124315
  31. Correlation between CD10 stromal expression and disease-free survival rate in breast cancer patients. PMID: 23575921
  32. E-cadherin and CD10 in endometrial lesions is not correlated, but reduced expression of both molecules could be critical for progression of endometrial carcinoma PMID: 25282623
  33. Evaulate CD10 and mucin expression in relation to microsatellite instability/mismatch repair proteins in 47 cases of small bowel adenocarcinoma. PMID: 25759539
  34. This meta-analysis indicates that rs3736187 (A/G) polymorphisms may be a potential beneficial single nucleotide polymorphism (SNP), which are associated with a decreased risk in Alzheimer disease. PMID: 25125048
  35. Follicular lymphoma CD10(pos) follicular helper T cells specifically display an IL-4(hi)IFN-gamma(lo) cytokine profile and encompass the malignant B-cell-supportive follicular helper T cells subset. PMID: 25733581
  36. Letter: suggest that CD10 is not a useful marker to differentiate seminoma from non-seminomatous germ cell tumours. PMID: 25713420
  37. This study gives substantial proof to the various models/research papers explaining the role of CD10 in breast cancer pathogenesis. PMID: 25308002
  38. Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin. PMID: 25279712
  39. Serum CD10 levels might serve as a useful marker of synchronous and metachronous liver metastasis in colorectal cancer. PMID: 24972738
  40. PKCepsilon activation may have therapeutic efficacy for AD by reducing neurotoxic Abeta accumulation as well as having direct anti-apoptotic and synaptogenic effects PMID: 24848988
  41. High CD10 expression is associated with squamous cell carcinoma. PMID: 24895167
  42. MME expression level was differentially altered in Crohn disease and ulcerative colitis patients. PMID: 23827863
  43. the recombinant brain-targeted neprilysin, ASN12, may be an effective treatment for AD and warrant further investigation in clinical trials. PMID: 24825898
  44. Expression of CD10 is associated with therapeutic resistance and cancer stem cell-like properties of head and neck squamous cell carcinoma. PMID: 24874475
  45. A direct up-regulation of stroma fibroblast MME expression under hypoxia might contribute to enhanced aggressiveness of hypoxic cancers. PMID: 24460801
  46. Data indicate an important, previously neglected, role of NEP for regulation of luminal factors in the epididymis and suggest a novel role for CNP/guanylyl cyclase B in the epididymal epithelium. PMID: 24099862
  47. only seminomas and intratubular germ cell neoplasia, the precursors of germ cell tumours, express CD10 PMID: 23857215
  48. study suggests that the severity of periodontal disease may be associated with the expression of metalloendopeptidase genes, including NEP, ECE1 and ADAM17, in the buccal mucosal epithelium. PMID: 23360525
  49. CD10 might be involved in the development of endometriosis due to its influence on CD44-dependent cell adhesion. PMID: 23653392
  50. Overexpression of membrane metalloendopeptidase inhibits substance P stimulation of cholangiocarcinoma growth. PMID: 24603459

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed