Recombinant Human CD130 (gp130) Protein
Beta LifeScience
SKU/CAT #: BLA-10823P
Recombinant Human CD130 (gp130) Protein
Beta LifeScience
SKU/CAT #: BLA-10823P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P40189 |
Synonym | CD130 CD130 antigen CDw130 gp130 GP130 RAPS IL 6R beta IL-6 receptor subunit beta IL-6R subunit beta IL-6R-beta IL-6RB IL6 ST IL6RB_HUMAN IL6ST Interleukin 6 receptor subunit beta Interleukin receptor beta chain Interleukin-6 receptor subunit beta Interleukin-6 signal transducer Membrane glycoprotein 130 Membrane glycoprotein gp130 Oncostatin M receptor Oncostatin M receptor alpha subunit Oncostatin-M receptor subunit alpha |
Description | Recombinant Human CD130 (gp130) Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHF TIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |