Recombinant Human CD134 / OX40L receptor Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10832P
Recombinant Human CD134 / OX40L receptor Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10832P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P43489 |
Synonym | ACT 35 ACT35 ACT35 antigen ATC35 antigen CD 134 CD134 CD134 antigen IMD16 Lymphoid activation antigene ACT35 OX 40 OX40 OX40 antigen OX40 cell surface antigen OX40 homologue OX40L receptor TAX transcriptionally activated glycoprotein 1 receptor TAX transcriptionally-activated glycoprotein 1 receptor TNF receptor superfamily member 4 TNFRSF 4 TNFRSF4 TNR4_HUMAN Tumor necrosis factor receptor superfamily member 4 Txgp 1l Txgp1 Txgp1l |
Description | Recombinant Human CD134 / OX40L receptor Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSS KPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPC PPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQE TQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Molecular Weight | 65 kDa including tags |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized rhCD252-His (Cat:CHI-HF-201CD252) at 20μg/ml (50μl/well) can bind rhCD134-HFc (Cat:CHI-HF-211CD134), The EC50 is 0.05-0.1μg/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
Target Details
Target Function | Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.; (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Associated Diseases | Immunodeficiency 16 (IMD16) |
Gene Functions References
- High OX40 expression in Ovarian carcinoma is correlated with chemosensitivity and improved recurrence free survival in Ovarian carcinoma . Patients might therefore benefit from a second line therapy. PMID: 29661166
- Increased OX40 expression is associated with gastric cancer. PMID: 29529339
- this study demonstrates that cSCCs contain an abundance of Tregs which can suppress tumoral effector T cell function and that activation of the costimulatory receptor OX40 enhances tumoral T cell responses. PMID: 27034329
- OX40 expression on T cells was positively associated with obesity in humans. PMID: 28612217
- Metabolically active CD4+ T cells expressing Glut1 and OX40 preferentially harbor HIV during in vitro infection. PMID: 28892135
- this study investigated whether CD134 is preferentially expressed on CD4 T cells in drug-induced hypersensitivity syndrome . PMID: 27174092
- blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
- Low OX40 expression is associated with colorectal cancer. PMID: 26439988
- OX40 and its ligand are co stimulators for T lymphocytes. PMID: 26755473
- These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721
- Malaria patients and Plasmodium-infected rodents exhibit enhanced expression of the co-stimulatory receptor OX40 on CD4 T cells, which is abrogated following coordinate PD-1 co-inhibitory pathways, which are also upregulated during malaria. PMID: 25891357
- Identified two key amino acid residues within CD134 that are required for its interaction with herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to CD134. PMID: 26202244
- TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID: 25148371
- High expression of OX40 is associated with type 1 diabetes. PMID: 24797972
- A cysteine-rich domain of CD134 that is critical for binding to the HHV-6B glycoprotein gH/gL/gQ1/gQ2 complex and HHV-6B infection. PMID: 25008928
- cirrhotic and hepatocellular carcinoma fragments moderately and highly infiltrated by Tregs, respectively, expressing OX40 PMID: 24756990
- data show that Ag-specific CD4(+) CD25(+) CD134(+) CD39(+) T cells are highly enriched for Treg cells, form a large component of recall responses and maintain a Treg-cell-like phenotype upon in vitro expansion. PMID: 24752698
- expression is associated with breast cancer in a stage dependent manner PMID: 23502335
- OX40 signals regulate CD8 T cell survival at least in part through maintaining expression of the anti-apoptotic molecule A1 PMID: 23936461
- Hyperactivation of the Akt pathway in Teff cells from children with lupus nephritis is associated with reduced induction of TRAF6 and up-regulation of OX40, which may cause Teff cell resistance to Treg cell-mediated suppression. PMID: 23896866
- This study identified OX40 as a key molecule and biomarker for rapid progression of HTLV-1-associated myelopathy/tropical spastic paraparesis. PMID: 23651542
- CD134 is a cellular receptor specific for human herpesvirus-6B entry. PMID: 23674671
- Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816
- CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199
- We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196
- PAPP-A level was significantly related to soluble and membrane-bound OX40L in patients with ACS. PMID: 21111564
- Compared with control group, the expression of OX40 and Bcl-2 was significantly higher in allergic rhinitis. PMID: 19253527
- Transgenic OX40 forms a signaling complex in T cells that contains phosphoinositide 3-kinase (PI3K) and protein kinase B (PKB). PMID: 21289304
- High OX40 expression may be associated with malignant transformation, progression, invasion and metastasis in breast cancer biology. PMID: 20634005
- Possible proinflammatory effects of OX40L on the pathogenesis of atherosclerois. PMID: 21086790
- This study has shown that activation of OX40 induces CCL20 expression in the presence of antigen stimulation. PMID: 20400327
- The rs2298212G/A polymorphism in OX40 gene may be associated with the severity of coronary atherosclerotic disease. PMID: 20376799
- Data suggest the role of Perforin + cytotoxic T lymphocytes and CD134+ cells in the pathogenesis of autoimmunity of SLE. PMID: 20306696
- Pimecrolimus inhibits up-regulation of OX40 and synthesis of inflammatory cytokines upon secondary T cell activation by allogeneic dendritic cells. PMID: 12296857
- CD134 positive cells are identified within inflammatory lesions of active multiple sclerosis (MS), acute MS and chronic active MS as well as in acute disseminated leukoencephalitis patients. PMID: 14644025
- Mutagenesis showed that Asp60 and Asp62 are required for interaction with FIV, and modeling studies localized these two residues to the outer edge of domain 1 PMID: 15592478
- The expression of CD134 was markedly higher, compared to CD137, both on the day of the surgery and ten days after colorectal cancer surgery. PMID: 15638367
- Deficiencies in OX40 and CD30 signals were additive, secondary Ab responses were ablated.OX40/CD30 double-knockout OTII transgenic T cells fail to survive compared with normal T cells when cocultured with CD4(+)CD3(-) cells in vitro. PMID: 15778343
- Decrease in OX40 expression posttransplant includes the defective reconstitution of Treg cells, and the active inhibition of gene transcription by cyclosporine. PMID: 15808546
- stimulation of OX40/4-1BB rendered cells sensitive to apoptosis induced by TNF-alpha and reduced activation of NF-kappaB. OX40/4-1BB stimulation repressed the mitogen response in activated CD25+CD4+ T cells and preactivated CD8+ T cells PMID: 15941918
- CD3+ T lymphocytes co-expressing CD134 and CD137 antigens on peripheral blood revealed an increased percentages of OX-40/CD137 positive cells in patients with Graves' disease (p<0.025) compared to the controls. PMID: 16232366
- The relevance of these findings is supported by the vital functions fulfilled by OX40 in mammals as reflected by the high level of evolutionary conservation. PMID: 16329997
- The coexpression of CD25 and the costimulatory molecule CD134 on memory T-cells provides a novel marker for type 1 diabetes-associated T-cell immunity. PMID: 16380476
- OX40 ligation on CD4(+) T cells represents a potentially novel immunotherapeutic strategy that should be investigated to treat and prevent persistent virus infections, such as HIV-1 infection. PMID: 16456009
- OX40 is induced transiently on CD8(+) T cells upon activation and its signals contribute to both clonal expansion and functional reinforcement PMID: 16750861
- In the present study we found that costimulation via OX40 and TNF-R in OX40-expressing HIV-1-infected T cell lines leads to a marked reduction of HIV-1 production associated with rapid cell death. PMID: 18327975
- The expression of OX40 on CD4+ T cells in sentinel lymph nodes draining primary melanomas decreased withe more advanced tumor features, suggesting an immunosuppressive effect. PMID: 18374895
- Activity of OX40 ligand is enhanced by oligomerization and cell surface immobilization. PMID: 18397322
- the frequency of the most frequent haplotype, C-C-A-A, was significantly lower and that of the second most frequent, C-T-G-A, was significantly higher in hypertensive subjects than in controls. This difference was observed only in female patients PMID: 18398332
- These data offer a novel approach for UCB Treg expansion using aAPCs, including those coexpressing OX40L or 4-1BBL. PMID: 18645038