Recombinant Human CD146 Protein

Beta LifeScience SKU/CAT #: BLA-10850P

Recombinant Human CD146 Protein

Beta LifeScience SKU/CAT #: BLA-10850P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P43121
Synonym A32 antigen CD 146 CD146 CD146 antigen Cell surface glycoprotein MUC18 Cell surface glycoprotein P1H12 Gicerin Mcam Melanoma adhesion molecule Melanoma associated antigen A32 Melanoma associated antigen MUC18 Melanoma associated glycoprotein MUC18 Melanoma cell adhesion molecule Melanoma-associated antigen A32 Melanoma-associated antigen MUC18 MelCAM MUC 18 MUC18 MUC18_HUMAN S endo 1 S endo 1 endothelial associated antigen S-endo 1 endothelial-associated antigen
Description Recombinant Human CD146 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGL SQSQGNLSHVDWFSVHKEKRTLIFRVRQGQGQSEPGEYEQRLSLQDRGAT LALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPNIQVNPLGIPV NSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSG LYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTE KVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN DNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKRE AGGGYRCVASVPSIPGLNRTQLVNVAIFGPPWMAFKERKVWVKENMVLNL SCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECT ASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTER KLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITL PPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Molecular Weight 97 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References
Tissue Specificity Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progress

Gene Functions References

  1. MCAM coordination of apical-basal polarity and planar cell polarity provides insight into the general mechanisms of morphogenesis. PMID: 28589943
  2. CD146 suppresses BC progression as a target of CD44-downstream signaling PMID: 29121955
  3. Cultured early passage ASCs contained low levels of CD146 mRNA, which was expressed in two different splicing variants, at a relatively high amount of the CD146-long form and at a relatively low amount of the CD146-short form. ASCs contained low levels of CD146 protein, which consisted predominantly long form and a small amount of short form. PMID: 28549249
  4. In summary, we have shown that MUC18/Muc18 may serve as a regulator of airway inflammation and mucus overproduction, two important features of type 2-high asthma. Our data suggest that MUC18/Muc18 or its downstream signaling mediators may be targets for potential therapeutic agents. PMID: 28451734
  5. CD146 promoter polymorphisms were not associated with the risk of clear cell renal carcinoma in Chinese population. The rs3923594 was an independent predictor of recurrence in with localized ccRCC. PMID: 28626293
  6. We demonstrate that ER(+) breast cancers contain two CAF subtypes defined by CD146 expression. CD146(neg) CAFs suppress ER expression in ER(+) breast cancer cells, decrease tumor cell sensitivity to estrogen, and increase tumor cell resistance to tamoxifen therapy PMID: 27702820
  7. CD146 functions as a suppressor of tumorigenesis and cancer stemness in CRC through inactivating the canonical Wnt/beta-catenin cascade PMID: 27302922
  8. data identify the anatomy and phenotype of a novel class of committed myogenic progenitor in human post-natal skeletal muscle of subendothelial cells associated with the abluminal surface of microvascular compartment distinct from satellite cells PMID: 29186180
  9. These findings identify CD146 as a novel retention signal that traps macrophages within the artery wall, and a promising therapeutic target in atherosclerosis treatment. PMID: 28084332
  10. CD146 was expressed in all cases of Ph-positive B- cell acute lymphoblastic leukemia and in the vast majority of T-cell acute lymphoblastic leukemia PMID: 26102234
  11. Our results suggest that MCAM may serve as a novel therapeutic target to overcome chemoresistance in SCLC. PMID: 28646020
  12. Authors show that KDM3A regulates MCAM expression both through a direct mechanism, involving modulation of H3K9 methylation at the MCAM promoter, and an indirect mechanism, via the Ets1 transcription factor. PMID: 28319067
  13. increment of CD146 expression indicates gradual change of cultured annulus fibrosus cells to express a contractile phenotype and that transforming growth factor beta1 enhances this cellular commitment PMID: 27273299
  14. CD146 positivity in immunohistological analysis of 11 MRT patient samples was associated with poor patient outcomes. These results suggest that CD146 defines a distinct sub-population in MRT with high tumorigenic capacity and that this marker represents a promising therapeutic target. PMID: 27041577
  15. Promoter methylation of MCAM, ERalpha and ERbeta have a potential to be utilized as biomarker for the early detection of prostate cancer (PC) as their sensitivity and specificity seem to be better than serum PSA. PMID: 28147335
  16. MCAM promotes tamoxifen resistance by transcriptionally suppressing ERalpha expression and activating the AKT pathway, followed by induction of epithelial-mesenchymal transition. PMID: 27838413
  17. High MCAM expression is associated with lung metastasis in malignant melanoma. PMID: 27151304
  18. Results provide evidence that MUC18 promotes viral infections both in vivo and in vitro. PMID: 27701461
  19. soluble CD146 is released from the peripheral vasculature in response to venous stretch and may reflect systemic congestion in chronic heart failure patients PMID: 28062630
  20. results indicate that CD146 can be targeted in vivo by the radiolabeled OI-3 antibodies PMID: 27776176
  21. Findings suggest that decreased CD146 expression in cancer-associated fibroblasts promotes pancreatic cancer progression. PMID: 26373617
  22. METCAM/MUC18 positively promotes tumorigenesis of human breast cancer SK-BR-3 cells via increasing the signal in survival and proliferation pathways. PMID: 27125403
  23. sCD146 levels are elevated in patients with systemic sclerosis, but decreased sCD146 levels are observed in SSc patients with pulmonary arterial hypertension PMID: 27726047
  24. Nestin and CD146 are expressed in breast cancer cells with highly aggressive potency. They might contribute to disease relapse in breast cancer by activating the epithelial-mesenchymal transition pathway and assist tumor neovascularization. PMID: 28347241
  25. The results demonstrated isolation of specific scFv with frequency of 40 % which showed significant binding with the epitope in both ELISA and fluorescence-activated cell sorting (FACS) analyses. The antibody inhibited the migration (76 %) and invasion (67 %) of MUC18 positive cell line. The results suggest the specific anti-MUC18 scFv as an effective antibody for breast cancer immunotherapy PMID: 27565656
  26. We provide the first report that pro-angiogenic genes PECAM1, PTGS1, FGD5, and MCAM may play a vital role in pathological dermal angiogenesis disorders of psoriasis. PMID: 26748901
  27. Results showed that increased human METCAM/MUC18 expression in ovarian cancer SK-OV-3 cells suppressed tumorigenesis and ascites formation in nude mice, suggesting that human METCAM/MUC18 plays a suppressor role in the progression of ovarian cancer, perhaps by reducing proliferation and angiogenesis. PMID: 26906545
  28. CD146 dexpression efines a subpopulation of human mesenchymal stem cells capable of bone formation and in vivo trans-endothelial migration. PMID: 26753846
  29. Results showed that CD146 promoted metastasis of hepatocellular carcinoma (HCC) cells and predicted poor prognosis of HCC patients. CD146 induced epithelial mesenchymal transition through probably IL-8 up-regulation and STAT1 down-regulation. PMID: 26928402
  30. Data indicate that CD146 antigen is an effective cell surface marker for enriching tumor-propagating cells (TPCs) in primary sarcomas. PMID: 26517673
  31. MUC18 is an independent prognostic factor for clear cell renal cell carcinoma PMID: 26617818
  32. CD146 is a novel and useful marker for predicting senescence in human umbilical cord blood-derived Mesenchymal stem cells (hUCB-MSCs), and CD146 can potentially be applied in quality-control assessments of hUCB-MSC-based therapy. PMID: 26941359
  33. ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM PMID: 25995384
  34. The expression of CD146 and HIF1a was positively correlated with EGFR and CD31, respectively in salivary gland adenoid cystic carcinoma. PMID: 25997612
  35. a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1 PMID: 26004137
  36. Combined EpCAM/MCAM CellSearch enrichment thus increased the CTC detection rate. PMID: 25552367
  37. Results identified MCAM as a novel YAP target in hepatocellular carcinoma (HCC) but not in breast and colon cancer cells. MCAM serum levels were specifically elevated in HCC suggesting it as a specific diagnostic tool for HCC. PMID: 25728681
  38. CD146, P53, and Ki-67 are overexpressed in uterine sarcoma PMID: 26293576
  39. These data suggest CDCP1 expression can be used to identify a subset of marrow fibroblasts functionally distinct from CD146+ fibroblasts. PMID: 25275584
  40. Results show that that CD146 is expressed in 41% of gastric neoplasm cells and correlated positively with lymph node metastasis and epithelial-mesenchymal transition markers making it a good prognostic factor. PMID: 22754372
  41. MCAM is a major GAL-1 ligand is largely dependent on melanoma malignancy. PMID: 25756799
  42. MCAM is expressed by effector CD8+ T lymphocytes and it is strikingly upregulated during multiple sclerosis relapses. MCAM blockade restricts the transmigration of CD8(+) T lymphocytes across human blood-brain barrier endothelial cells. PMID: 25869475
  43. HuMETCAM/MUC18 levels in ovarian carcinomas and metastatic lesions were significantly higher than in normal tissues and cystadenomas. PMID: 25510693
  44. In peripheral stenotic arteriosclerotic disease the proangiogenic potency of MUC18 may play a role in angiogenesis of collaterals, whereas in dilatative aortic diseases the induction of collaterals is typically not evident. PMID: 25729916
  45. Suggest endothelial CD146 as a target for specific drug delivery in hepatocellular carcinoma. PMID: 25238265
  46. Data proposed a novel signaling mechanism by which Sema 3A regulates PTEN, FOXO 3a and MelCAM in a coordinated manner that leads to suppression of breast cancer growth and angiogenesis. PMID: 24727891
  47. Authors conclude therefore that ETs upregulate MCAM in an Akt and ERK/MEK-dependent, but CREB-independent manner, providing an understanding for possible pharmacologic intervention in progressing melanoma. PMID: 24743054
  48. expression behaves as a molecular warning of melanoma progression PMID: 24902661
  49. With the ability of migration and survival in the advanced osteoarthritis cartilage, CD146+ chondroprogenitors might be "tissue-specific" for cartilage tissue regeneration. PMID: 25266708
  50. functional characterization of N-acetylglucosaminyltransferases III and V in human melanoma cells PMID: 24726881

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed