Recombinant Human CD151 Protein
Beta LifeScience
SKU/CAT #: BLA-10859P
Recombinant Human CD151 Protein
Beta LifeScience
SKU/CAT #: BLA-10859P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CD151 CD151 antigen CD151 molecule CD151 molecule (Raph blood group) CD151_HUMAN GP27 hemidesmosomal tetraspanin CD151 Membrane glycoprotein SFA-1 MER2 PETA-3 PETA3 Platelet endothelial tetraspan antigen 3 platelet surface glycoprotein gp27 Platelet-endothelial cell tetraspan antigen 3 Platelet-endothelial tetraspan antigen 3 RAPH Red blood cell antigen MER2 SFA 1 SFA1 Tetraspanin-24 Tspan-24 TSPAN24 |
Description | Recombinant Human CD151 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGEFNEKKTTCGTVCLKYLLFTYNCCLWLAGLAVMAVGIWTLALKSDYIS LLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLII FLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQ QEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASN IYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKL EHY |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |