Recombinant Human CD163 Protein

Name: Recombinant Human CD163 Protein
Brand: Beta LifeScience
SKU: BLA-10868P
Availability: InStock

Collections: Cluster of differentiation (cd) proteins, Fc receptors, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	Q86VB7
Synonym	C163A_HUMAN CD 163 CD163 CD163 antigen CD163 molecule Hemoglobin scavenger receptor M130 M130 antigen precursor Macrophage associated antigen MM130 OTTHUMP00000238617 OTTHUMP00000238618 OTTHUMP00000238619 OTTHUMP00000238620 SCARI1 Scavenger receptor cysteine rich type 1 protein M130 sCD163 Soluble CD163
Description	Recombinant Human CD163 Protein was expressed in Wheat germ. It is a Protein fragment
Source	Wheat germ
AA Sequence	NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESAL WDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC
Molecular Weight	36 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Useful for Antibody Production and Protein Array
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.; After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.
Subcellular Location	[Soluble CD163]: Secreted.; Cell membrane; Single-pass type I membrane protein. Note=Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.
Database References	HGNC: 1631 OMIM: 605545 KEGG: hsa:9332 STRING: 9606.ENSP00000352071 UniGene: Hs.504641
Tissue Specificity	Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed a

Gene Functions References

high plasma levels of sCD163 is associated with measles virus infection. PMID: 29795672
Increased sCD163 levels in sputum are associated with the impairment of lung function in asthma patients PMID: 30246699
Expression of CD163 in urinary bladder cancer cells is significantly correlated with macrophage infiltration and might have a tumor promoting impact. PMID: 29288002
A separate measurement of the two forms of CD163 constituting 'soluble CD163' in plasma may therefore add to the diagnostic and prognostic value. PMID: 28084321
our results suggest that MR and CD163 may be novel biomarkers for CRC detection and survival evaluation. PMID: 29226859
Data suggest a novel pathophysiological role of CD163 in type 2 diabetes; monocyte surface CD163 levels are significantly associated with insulin resistance in patients with type 2 diabetes; the association of insulin resistance with soluble CD163 levels is less significant. This study was conducted in Japan. PMID: 29445750
Detection of the CD163 antigen on cancer cells might be a useful marker for evaluating the clinical course of patients with clear cell renal cell carcinoma PMID: 28687956
CD163-expression by cancer cells was significantly associated with MI and clinicopathological data. Patients with CD163-positive tumors had significantly shorter disease-free survival (DFS) after RT. PMID: 29725763
Plasma CD163 levels were increased in obese and type 2 diabetes mellitus patients compared to controls. PMID: 28406702
soluble CD163 is associated with markers of liver necro-inflammation and glucose homoeostasis in non-alcoholic fatty liver disease. PMID: 28715286
The effect of LPS in the expression of CD163 and CD206 on monocytes is not reverted in LPS tolerant cells, and the inhibition of inflammatory cytokines in tolerant cells is not related with modulation of these receptors PMID: 26352275
The cumulative incidence of de novo-onset cGVHD was higher in patients with higher plasma soluble CD163 concentrations at day 80 than those with lower concentrations (75% versus 40%, P = .018). The cumulative incidence of de novo- or quiescent-onset cGVHD did not differ statistically according to concentrations of the 3 other proteins at day 80. PMID: 28455006
Although sCD163 level cannot predict the development of varices, it serves as a good predictor for the detection of size of varices (large varices), the need of prophylactic interventions, and risk of variceal bleeding. sCD163 level is a helpful indicator with the progression of cirrhosis and portal hypertension. PMID: 28282272
CD163 and ferritin are biomarkers of functional outcomes in intracerebral hemorrhage. PMID: 28392117
the simultaneous detection of both plasma sCD14 and IL-6 is a promising diagnostic approach to identify active pulmonary tuberculosis, and further, measurement of TNF-alpha and sCD163 can identify the most severe cases of tuberculosis. PMID: 27591510
The macrophage activation marker CD163 was increased in patients with active pulmonary TB compared with age- and sex-matched control subjects. PMID: 27684274
alveolar macrophages from asthmatic subjects have reduced cell-surface expression of CD163, which suggests that CD163 might modulate the pathogenesis of asthma PMID: 26376364
Serum sCD163 might be a potential biomarker for predicting the severity and prognosis of PM/DM-related interstitial lung disease PMID: 28103926
Soluble CD163 reflecting macrophage activation is associated with morphological features of non-alcoholic fatty liver disease. An independent association between sCD163 and cytokeratin-18 suggests that apoptosis may contribute to macrophage activation in NAFLD/NASH. PMID: 27102725
Most cases of histiocytic sarcoma expressed histiocytic markers CD68 (6 of 7 cases), CD163 (5 of 5 cases), and PU.1 (3 of 4 cases). PMID: 28805986
Within a diabetic cohort, the percentage of monocytes expressing CD163 was decreased in those subjects with complications, compared to those without complications. These changes were not accompanied by a change in gene expression. Glucocorticoids increased CD163 expression in cultured peripheral blood monocytes from non-diabetic persons. PMID: 27354410
sCD163 was markedly elevated in autoimmune hepatitis (AIH) in the acute phase, normalised by successful treatment in complete responders, but remained higher in the incompletely responding cases. Our results demonstrate macrophage activation in AIH paralleling disease activity, severity and treatment response, suggesting a role for macrophage activation in AIH. PMID: 27679428
High CD163 expression is associated with glomerular inflammation in lupus nephritis. PMID: 27242373
analysis of plasma CXCL10, sCD163 and sCD14 in virological suppression and risk of cardiovascular disease PMID: 27355513
we found that higher percentages of circulating CD14+CD204+, CD14+CD163+CD204+ M2-like monocytes were significantly associated with TNM stage, lymph node metastasis, and histological differentiation. PMID: 28639912
CD163 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
Soluble CD163, which is identified as a marker of inflammation and type II diabetes, is elevated in polycystic ovary syndrome. PMID: 26985764
soluble CD163 modulates the immune response to Dermatophagoides pteronyssinus allergens potentiating anti-inflammatory, homeostatic mechanisms. PMID: 27100336
The mean serum-soluble CD163 level was higher in the ANCA-associated renal vasculitis patients with infectious complications than in the active-vasculitis patients, inactive-vasculitis patients, and normal controls. PMID: 27094919
we have developed a highly sensitive targeted probe capable of detecting CD163-expressing macrophages that could provide useful information about the state of the atheromatous lesions. PMID: 26616677
A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin. PMID: 26568320
Increased soluble CD163 blood levels in hepatocellular carcinoma patients correlates with rapid hepatocellular carcinoma progression. PMID: 26549495
these data indicate that sCD163 is a prognostic marker in B-CLL. PMID: 25747973
sCD163 is a sensitive marker protein for liver failure. PMID: 26339412
CD163-positive macrophages predict outcome in follicular lymphoma, but their prognostic impact is highly dependent on treatment received. PMID: 25869385
therapy with rituximab, cyclophosphamide and fludarabine resulted in a significant reduction in the number of non-classical CD14+CD16++ monocytes and soluble form of CD163 but upregulation of membrane-associated monocyte CD163 PMID: 26135617
Renal graft CD163+ infiltrates correlated strongly with interstitial inflammation, tubulitis, and peritubular capillaritis. PMID: 26087825
Higher levels of circulating monocyte-platelet aggregates are correlated with viremia and increased sCD163 levels in HIV-1 infection. PMID: 25109683
CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation. PMID: 26045748
The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection. PMID: 26569178
Soluble CD163 is increased in patients with acute pancreatitis. PMID: 26209500
CD163 may be correlated with disease severity and the disease progression in patients with hemorrhagic fever with renal syndrome; however, the underlying mechanisms should be explored further. PMID: 25392926
Suggest MelanA-negative spindle-cell associated melanoma constitutes a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin. PMID: 25602697
The scavenger receptor CD163 has been found to be over-expressed in Head and neck squamous cell carcinoma. PMID: 24858806
Show a high percentage of CD163+ tumor-associated macrophages and a low percentage of S100+ dendritic cells in thymic carcinoma samples. PMID: 25499804
CD163 is a biomarker for the clinical assessment of macrophage proliferation and activity that would help in risk prediction of bone and lung involvement and monitoring treatment response PMID: 25587690
This study describe elevated soluble CD163 (sCD163)levels in gestational diabetes mellitus (GDM) and identify human placenta as a novel source of sCD163 suggesting that placental tissues might contribute to the increased levels of circulating sCD163 in GDM pregnancies. PMID: 24983948
could be potentially used as an immune diagnostic marker for malignant pleural effusion PMID: 25944005
Soluble CD163 may be a marker of "unhealthy" fat distribution in obese subjects. PMID: 25376508
IL-8 might be involved in poor clinical outcomes via generation of CD163-positive M2 macrophages, and these factors in addition to N status might have prognostic value in patients with resectable oral squamous cell carcinoma PMID: 25461761

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.