Recombinant Human CD164 Protein
Beta LifeScience
SKU/CAT #: BLA-10870P
Recombinant Human CD164 Protein
Beta LifeScience
SKU/CAT #: BLA-10870P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q04900 |
Synonym | CD164 antigen CD164 antigen, sialomucin CD164 molecule, sialomucin endolyn ESM MGC 24 MUC 24 Multi glycosylated core protein 24 Putative mucin core protein 24 precursor Putative mucin core protein precursor 24 RP11-425D10.9 sialomucin Sialomucin CD164 |
Description | Recombinant Human CD164 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTS APVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHN STVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGT TNNTVTPTSQPVRKSTFD |
Molecular Weight | 18 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |