Recombinant Human CD19 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10892P
Recombinant Human CD19 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10892P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P15391 |
Synonym | Antibody deficiency due to defect in CD19 Antibody deficiency due to defect in CD19, included AW495831 B lymphocyte antigen CD19 B lymphocyte surface antigen B4 B-lymphocyte antigen CD19 B-lymphocyte surface antigen B4 B4 CD19 CD19 antigen CD19 molecule Cd19 protein CD19_HUMAN CVID3 Differentiation antigen CD19 Leu 12 Leu-12 Leu12 MGC109570 MGC12802 T-cell surface antigen Leu-12 |
Description | Recombinant Human CD19 Protein (Fc Tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLP GLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSG ELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEG EPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHP KGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMS FHLEITARPVLWHWLLRTGGWK |
Molecular Weight | 30 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |
Target Details
Target Function | Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein. |
Database References | |
Associated Diseases | Immunodeficiency, common variable, 3 (CVID3) |
Tissue Specificity | Detected on marginal zone and germinal center B cells in lymph nodes. Detected on blood B cells (at protein level). |
Gene Functions References
- diffuse large B cell lymphoma lacking CD19 or PAX5 expression were more likely to have mutant TP53. PMID: 28484276
- The impairment of Bregs and CD19+/BTLA+ cells could play an important pathogenic role in multiple sclerosis (MS). PMID: 27412504
- Inhibition of Akt signaling during ex vivo priming and expansion gives rise to CD19CAR T cell populations that display comparatively higher antitumor activity PMID: 28331616
- CD19-specific triplebody SPM-1 mediated potent lysis of cancer-derived B cell lines and primary cells from patients with various B-lymphoid malignancies. PMID: 27825135
- The increase in CD19+CD24+CD27+ Bregs was closely associated with fasting insulin secretion. PMID: 28440417
- The preclinical activity, safety and PK profile support clinical investigation of MGD011 (MGD011 is a CD19 x CD3 DART bispecific protein )as a therapeutic candidate for the treatment of B-cell malignancies PMID: 27663593
- this study shows that CD19 isoforms enable resistance to adoptive cellular immunotherapy PMID: 28441264
- Anti-CD19-chimeric antigen receptors T cells synergistically exerted collaborative cytotoxicity against primary double-hit lymphoma cells with anti-CD38-chimeric antigen receptors T cells. PMID: 28595585
- Two infants with relapsed, refractory B-cell acute lymphoblastic leukemia went into complete remission after being treated with CD19-targeting CAR T cells derived from an unmatched donor PMID: 28193774
- These data provide proof-of-principle for the view that newly generated Ab-secreting cells can acquire a mature plasma cell phenotype that is accompanied by loss of CD19 expression at an early stage of differentiation and that aging is not an obligate requirement for a CD19(neg) state to be established. PMID: 28490574
- Results indicate the strong efficacy of FLAG-tagged CD19 CAR-T cells in solid and hematological cancer models. PMID: 28410137
- The histological observations suggested that the patients represent diverse cases of NHL like mature B-cell type, mature T-cell type and high grade diffuse B-cell type NHL. The findings indicate that patients with NHL may also be analyzed for status of PAX5, CD19 and ZAP70, and their transcriptional and post-translational variants for the differential diagnosis of NHL and therapy. PMID: 27748274
- The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia. PMID: 26852663
- a CD45+/CD19 - cell population in bone marrow aspirates correlated with the clinical outcome of patients with mantle cell lymphoma. PMID: 25739938
- CD19 is required for TLR9-induced B-cell activation. Hence CD19/PI3K/AKT/BTK is an essential axis integrating BCRs and TLR9 signaling in human B cells. PMID: 26478008
- High anti-EBV IgG levels in Crohn's disease are associated with 5-aminosalicylic acid treatment, tonsillectomy, and decrease of CD19(+) cells. PMID: 25914477
- We propose that CD81 enables the maturation of CD19 and its trafficking to the membrane by regulating the exit of CD19 from the ER to the pre-Golgi compartment PMID: 25739915
- we outline our approach to nonviral gene transfer using the Sleeping Beauty system and the selective propagation of CD19-specific CAR(+) T cells on AaPCs PMID: 25591810
- We demonstrate that this motif plays a role in the maturation and recycling of CD19 but in a CD81-independent manner. PMID: 26111452
- Studies indicate that anti-CD19 and anti-CD33 bispecific antibodies showed anticancer activity. PMID: 25883042
- The synaptic recruitment of lipid rafts is dependent on CD19-PI3K module and cytoskeleton remodeling molecules. PMID: 25979433
- gene deficiency results in severe lung disease in French patient PMID: 24684239
- propose a multilayer model of plasma cell (PC) memory in which CD19(+) and CD19(-) PC represent dynamic and static components, respectively, permitting both adaptation and stability of humoral immune protection PMID: 25573986
- Suppression of innate and adaptive B cell activation pathways by antibody coengagement of FcgammaRIIb and CD19. PMID: 24828435
- Human CD19 and CD40L deficiencies impair antibody selection and differentially affect somatic hypermutation. PMID: 24418477
- A lower primary CD24(hi) CD27(+) CD19(+) B cells may be an immunologic aspect of new-onset SLE that may be a useful tool to evaluate lupus activity and monitor the response to therapy. PMID: 24286662
- higher percentage of CD19+ cells in patients with acute appendicitis; decreases after appendectomy PMID: 24375063
- CD20 and CD19 targeting vectors induce activating stimuli in resting B lymphocytes, which most likely renders them susceptible for lentiviral vector transduction. PMID: 24244415
- Latently infected cells from patients with multiple sclerosis, treated with natalizumab, initiate differentiation to CD19+ cells that favor growth of JC polyomavirus. PMID: 24664166
- This inhibitory function of FcgammaRIIB in impairing the spatial-temporal colocalization of BCR and CD19 microclusters in the B cell immunological synapse may help explain the hyper-reactive features of systemic lupus erythematosus PMID: 24790152
- Considering that the CD19 complex regulates the events following antigen stimulation, the change in CD19 complex detected in transient hypogammaglobulinemia of infancy may be related to insufficiency of antibody production. PMID: 22820757
- CD19 emerged as a powerful predictor of event-free and overall survival in CNS diffuse large B-cell lymphomas and Burkitt lymphomas PMID: 24501214
- these data demonstrate that CD19 and CD32b differentially inhibit B cell expansion and plasma cell differentiation, depending on the nature of the activating stimuli, when engaged with monospecific Abs. PMID: 24442430
- CD19 expression in acute leukemia is not restricted to the cytogenetically aberrant populations. PMID: 23193950
- CD19 is expressed very early in B-cell development and is a good target for antibody therapy in lymphoblastic leukemia. PMID: 23277329
- The resulting CD19(high)/CD19(low) B-cell ratio increased markedly in the milk-tolerant group. PMID: 22563781
- Use of c-Myc transgenic mice deficient in CD19 expression leads to identification of a c-Myc:CD19 regulatory loop that positively influences B cell transformation and lymphoma progression. PMID: 22826319
- Results obtained through a large cohort of European caucasian patients with systemic sclerosis do not support the contribution of CD19, CD20, CD22, CD24 variants to the genetic susceptibility. PMID: 21961844
- Data indicate that among MDS cases, CD15+ and CD19+ cell TLs were positively correlated, and PBL TL was was not associated with hTERT genotype. PMID: 21635204
- Studies showed the qualitative and quantitative expression of four target surface antigens, CD19, CD20, CD22, and CD33, for which MoAbs are currently available for clinical use, in ALL. PMID: 21348573
- Data show that CD45+CD19- MCL-ICs play a role in the drug resistance of MCL, and this drug resistance was largely due to quiescent properties with enriched ABC transporters. PMID: 21599592
- A missense mutation of CD19 in the conserved tryptophan 41 in immunoglobulin superfamily domain resulted in antibody deficiency. PMID: 21330302
- Data suggest that CD19 and CD33 are present on the surface of the leukemic cell lines such that they can be connected by a single sctb molecule. PMID: 21081841
- CD23 and CD19 are important factors that associated with serum total IgE in the pathogenesis of allergic rhinitis. PMID: 20359104
- binding sites for CD19 and CD16 have a role in antibody-dependent cellular cytotoxicity against B-lymphoid tumor cells PMID: 21339041
- Heterozygous loss of CD19 causes some changes in the naive B-cell compartment, but overall in vivo B-cell maturation or humoral immunity is not affected. PMID: 20445561
- Altered CD19/CD22 balance in Egyptian children and adolescents with systemic lupus erythematosus. PMID: 20726320
- The CD27(+) B-cell population was found to highly express CXCR3 in chronic hepatitis C (CHC), thus suggesting that the CD27(+) B-cell population was recruited from peripheral blood to the inflammatory site of the liver of CHC. PMID: 20377416
- Aberrant expression of CD19 in acute myeloblastic leukemia with t(8;21) involves a poised chromatin structure and PAX5. PMID: 20208555
- Studies indicate taht B lymphocytes proliferated when approximately 100 antigen receptors per cell, 0.03 percent of the total, were coligated with CD19. PMID: 20164433