Recombinant Human CD2 Protein

Beta LifeScience SKU/CAT #: BLA-10897P

Recombinant Human CD2 Protein

Beta LifeScience SKU/CAT #: BLA-10897P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P06729
Synonym CD 2 CD2 CD2 antigen CD2 antigen (p50), sheep red blood cell receptor CD2 molecule CD2_HUMAN Erythrocyte receptor FLJ46032 LFA-2 LFA-3 receptor LFA2 LFA3 receptor Ly-37 Lymphocyte function antigen 2 lymphocyte-function antigen-2 OTTHUMP00000024366 Rosette receptor Sheep erythrocyte receptor SRBC T cell surface antigen CD2 T-cell surface antigen CD2 T-cell surface antigen T11/Leu-5 T-lymphocyte surface CD2 antigen T11
Description Recombinant Human CD2 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKEITNALETWGALGQDINL DIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLK IKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTT LTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVS KESSVEPVSCPEKGLD
Molecular Weight 25 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle.

Target Details

Target Function CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Database References

Gene Functions References

  1. A new prognostic model for HR-/HER2+ breast cancer based on the expression of MMP11 and CD2 was developed and the distant metastasis-free survival for patients in the high-risk group according to our model was significantly lower than that for those in the low-risk group. PMID: 28409241
  2. These results reveal an unexpected redundancy in the human NK cell response to human cytomegalovirus and suggest that CD2 provides "signal 2" in antibody-driven adaptive NK cell responses. PMID: 27117418
  3. Establish CD2 as a new susceptibility factor for systemic sclerosis in a European Caucasian population. PMID: 27385538
  4. the fundamental mechanism of glycosylation of human CD2 is to promote CD2-CD58 binding by conformational adjustment of CD2 PMID: 25984915
  5. CD58/CD2 is the primary costimulatory pathway in human CD28-CD8+ T cells. PMID: 26041540
  6. Both the mRNA expression levels and protein expression levels of HSP27 were increased in astrocytes from POAG patients compared with those from normal control, suggesting that mutation in CD2 might pose a risk for POAG in Chinese population. PMID: 24597656
  7. Although sMCs displayed immunoreactivity for one of the neoplastic antigens in the majority of SM patients, the aberrant CD2 and/or CD25 expression on sMCs is not as indicative of SM as the BMMC immunophenotype. PMID: 25402852
  8. ERGdel may be a pure surrogate of CD2-positivity--which has been suggested to be a good prognositc marker in childhood ALL PMID: 24072102
  9. Altogether, these results show that a high CD2 expression level is a hallmark of latently infected resting memory CD4(+) T cells in vivo. PMID: 23760244
  10. Aberrant CD2 expression appears to further determine a shorter progression free survival PMID: 22634534
  11. CD2-CD58/48 receptor-ligand interaction promotes and is required for nanotube formation in human natural killer cells. PMID: 23112830
  12. CD2 expression does not contribute to improve the diagnosis of systemic mastocytosis when compared with aberrant CD25 expression alone. PMID: 22222639
  13. CD2-mediated priming of resting natural killer (NK) cells is unaffected by their degree of functional maturation. PMID: 22084431
  14. CD2 signals more strongly to S6-ribosomal protein, whereas CD28 costimulation specifically induces signaling necessary for proper NF-kappaB activation. PMID: 22013130
  15. When isolated from multiple sclerosis patients, both nonmature and effector subsets of memory CD127(low) regulatory T cells exhibit kinetically distinct defects in suppression that are evident with CD2 pathway costimulation. PMID: 21300823
  16. analysis of the importance of homotypic NK-to-NK cell cross-talk through 2B4/CD48 and CD2/CD58 pairs and further present their differential and overlapping roles in human NK cells PMID: 20813844
  17. PTEN expression was up-regulated on RNA and protein level in freshly isolated human CD4(+) T cells following stimulation with CD28 or CD2. PMID: 11932928
  18. molecules redistribute to the uropod during T cell scanning PMID: 12032326
  19. Structural and functional studies of the extracellular domains of CD2 and CD58 and their complex. Review. PMID: 12369898
  20. CD2BP2 is the ligand of the membrane-proximal proline-rich tandem repeat of CD2 in detergent-soluble membrane compartments, but is replaced by Fyn SH3 after CD2 is translocated into lipid rafts upon CD2 ectodomain clustering. PMID: 12426371
  21. PSTPIP1 acts downstream of CD2/CD2AP to link CD2 engagement to the WASp-evoked actin polymerization required for synapse formation and T cell activation. PMID: 12530983
  22. This T cell surface antigen is linked to the actin-capping protein CAPZ via CMS and CIN85. PMID: 12690097
  23. another role of the CD2-CD58 pathway that allows nonimmune and immune cells to interact directly with dendritic cells and initiate innate and adaptive immune responses. PMID: 12714509
  24. CD2 mediates activation of the IFN-gamma intronic STAT binding region in mucosal T cells. PMID: 12731040
  25. CD2 mediates activation of a distal -3.6-kilobase STAT5 binding region of the interferon-gamma promoter. PMID: 15528362
  26. CD48 is a CD2 and CD244 (2B4)-binding protein PMID: 16803907
  27. We use this analysis to determine that the 2D Kd for CD2-CD58 is 5.4-7.6 molecules/microm2. 2D Kd analysis provides a general and quantitative measure of the mechanisms regulating cell-cell adhesion. PMID: 17085486
  28. T cell activation causes the CD58-bound CD2 to be recognized and immobilized at sites of cell-cell contact, thereby strengthening T cell-APC adhesion PMID: 17168569
  29. results showed that the expression of CD2 significantly increased with the severity of chronic HBV infection, which suggested that CD2 might contribute to the hepatocyte damage in chronic HBV infection PMID: 18318997
  30. Data suggest that detection of CD2 or CD13 expression in chronic lymphocytic leukemia (CLL) suggests familial CLL, and that CD38 expression does not carry the negative prognosis observed in sporadic CLL. PMID: 18431797
  31. the synergistic synthesis of IL-8 occurs when lymphocytes are stimulated through the CD2 pathway by CD58 on HT-29 cells, resulting in TNF-alpha release that, in turn, augments IL-8 synthesis and CD58 expression by the HT-29 cells PMID: 19109405
  32. during clinical remission, increases in CD58 expression, mediated by the protective allele, up-regulate the expression of FoxP3 through engagement of the CD58 receptor, CD2, leading to the enhanced function of TREG cells that are defective in MS PMID: 19237575
  33. CD2 functions as the master switch recruiting CD48 and Lck PMID: 19494291
  34. LFA-1 and CD2 synergize for the Erk1/2 activation in the Natural Killer (NK) cell immunological synapse PMID: 19502238
  35. CD244 inhibition and activation depends on CD2 and phospholipase C-gamma1 PMID: 19586919
  36. Genetic variants at CD2 are associated with rheumatoid arthritis risk PMID: 19898481
  37. CD2-CD58 binding site PMID: 11575926

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed