Recombinant Human CD24 Protein
Beta LifeScience
SKU/CAT #: BLA-10928P
Recombinant Human CD24 Protein
Beta LifeScience
SKU/CAT #: BLA-10928P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CD 24 CD24 CD24 antigen CD24 antigen (small cell lung carcinoma cluster 4 antigen) CD24 molecule CD24_HUMAN CD24A FLJ22950 FLJ43543 GPI linked surface mucin Heat stable antigen HSA MGC75043 Nectadrin Signal transducer CD24 Small cell lung carcinoma cluster 4 antigen |
Description | Recombinant Human CD24 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNP TNATTKAAGGALQSTASLFVVSLSLLHLYS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |