Recombinant Human CD27 Protein
Beta LifeScience
SKU/CAT #: BLA-10607P
Recombinant Human CD27 Protein
Beta LifeScience
SKU/CAT #: BLA-10607P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P26842 |
Synonym | CD 27 CD27 CD27 antigen CD27 molecule CD27_HUMAN CD27L receptor LPFS2 MGC20393 OTTHUMP00000238557 S152 T cell activation antigen CD27 T cell antivation antigen S152 T-cell activation antigen CD27 T14 TNFRSF 7 TNFRSF7 TNFSF7 Tp 55 Tp55 Tumor necrosis factor receptor superfamily member 7 |
Description | Recombinant Human CD27 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLV KDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA NAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSE MLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQED YRKPEPACSP |
Molecular Weight | 54 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |