Recombinant Human CD272/BTLA Protein
Beta LifeScience
SKU/CAT #: BLA-10616P
Recombinant Human CD272/BTLA Protein
Beta LifeScience
SKU/CAT #: BLA-10616P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q7Z6A9-2 |
Synonym | B and T lymphocyte associated protein B and T lymphocyte attenuator B and T lymphocyte associated B- and T-lymphocyte attenuator B- and T-lymphocyte-associated protein BTLA BTLA_HUMAN BTLA1 CD272 CD272 antigen FLJ16065 MGC129743 |
Description | Recombinant Human CD272/BTLA Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTGKQNELSDTAGREINLVDHHHHHH |
Molecular Weight | 15 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |