Recombinant Human CD3 Protein

Name: Recombinant Human CD3 Protein
Brand: Beta LifeScience
SKU: BLA-10941P
Availability: InStock

Collections: Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P07766P09693
Synonym	4930549J05Rik A430104F18Rik AW552088 Cd247 CD247 antigen CD247 antigen, zeta subunit CD247 molecule CD3 CD3 antigen, delta subunit CD3 delta CD3 epsilon CD3 eta CD3 gamma CD3 molecule delta polypeptide CD3 molecule, epsilon polypeptide CD3 molecule, gamma polypeptide CD3 zeta CD3-DELTA CD3d CD3D antigen delta polypeptide CD3d antigen, delta polypeptide (TiT3 complex) CD3d molecule delta CD3d molecule delta CD3 TCR complex CD3d molecule, delta (CD3-TCR complex) CD3D_HUMAN CD3E CD3e antigen CD3E antigen epsilon polypeptide CD3e antigen, epsilon polypeptide (TiT3 complex) CD3e molecule epsilon CD3e molecule epsilon CD3 TCR complex CD3e molecule, epsilon (CD3-TCR complex) CD3epsilon CD3G CD3g antigen CD3G antigen gamma polypeptide CD3g antigen, gamma polypeptide (TiT3 complex) CD3g molecule gamma CD3g molecule gamma CD3 TCR complex CD3g molecule, gamma (CD3-TCR complex) CD3H CD3Q CD3Z CD3zeta Ctg3 FLJ17620 FLJ17664 FLJ18683 FLJ79544 FLJ94613 IMD19 Leu-4 MGC138597 OKT3, delta chain OTTHUMP00000032544 T cell receptor T cell receptor T3 delta chain T cell receptor T3 gamma chain T cell receptor T3 zeta chain T cell receptor zeta chain T cell surface antigen T3/Leu 4 epsilon chain T cell surface glycoprotein CD3 T cell surface glycoprotein CD3 delta chain T cell surface glycoprotein CD3 epsilon chain T cell surface glycoprotein CD3 gamma chain T cell surface glycoprotein CD3 zeta chain T-cell antigen receptor complex, delta subunit of T3 T-cell antigen receptor complex, epsilon subunit of T3 T-cell antigen receptor complex, gamma subunit of T3 T-cell antigen receptor complex, zeta subunit of CD3 T-cell receptor T3 delta chain T-cell receptor T3 gamma chain T-cell surface antigen T3/Leu-4 epsilon chain T-cell surface glycoprotein CD3 delta chain T-cell surface glycoprotein CD3 epsilon chain T-cell surface glycoprotein CD3 gamma chain T3 T3d T3e T3g T3z TCRE TCRk Tcrz TCRzeta
Description	Recombinant Human CD3 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMD
Molecular Weight	39 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized OKT3 MAb at 10μg/mL (100μL/well) can bind this protein with a linear range of 0.3-5μg/mL.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.