Recombinant Human CD300C Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10959P
Recombinant Human CD300C Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10959P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q08708 |
Synonym | CD300 antigen-like family member C CD300c CD300c antigen CD300c molecule CLM-6 CLM6_HUMAN CMRF-35 CMRF-35A CMRF35 CMRF35 antigen CMRF35 leukocyte immunoglobulin-like receptor CMRF35-A1 CMRF35-like molecule 6 CMRF35A CMRF35A leukocyte immunoglobulin-like receptor CMRF35A1 IgSF16 Immunoglobulin superfamily member 16 LIR |
Description | Recombinant Human CD300C Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPE PSPHPGSLFSNVR |
Molecular Weight | 19 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |