Recombinant Human CD300e Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10961P
Recombinant Human CD300e Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10961P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q496F6 |
Synonym | CD300 antigen like family member E CD300 antigen-like family member E CD300e CD300e antigen CD300e molecule CD300LE CLM 2 CLM-2 CLM2 CLM2_HUMAN CMRF35 A5 CMRF35 like molecule 2 CMRF35-A5 CMRF35-like molecule 2 CMRF35A5 Immune receptor expressed on myeloid cells 2 IREM 2 IREM-2 IREM2 PIgR 2 PIgR-2 PIgR2 Poly Ig receptor 2 Poly-Ig receptor 2 Polymeric immunoglobulin receptor 2 |
Description | Recombinant Human CD300e Protein (denatured) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKG YNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNL NEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPP IFLVVNPGRNLSTGEVLTQNSGFRLSSPH |
Molecular Weight | 20 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |