Recombinant Human CD300LG Protein
Beta LifeScience
SKU/CAT #: BLA-10962P
Recombinant Human CD300LG Protein
Beta LifeScience
SKU/CAT #: BLA-10962P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q6UXG3 |
Synonym | CD300 antigen-like family member G CD300 molecule like family member g CD300g Cd300lg CLM-9 CLM9 CLM9_HUMAN CMRF35-like molecule 9 Nepmucin TREM-4 TREM4 Triggering receptor expressed on myeloid cells 4 |
Description | Recombinant Human CD300LG Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAE EEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESL LISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPA ATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPM QLNSTSAEDTSPALSSGSSKPRVSIPMVRVDHHHHHH |
Molecular Weight | 26 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |