Recombinant Human CD30L Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10631P
Recombinant Human CD30L Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10631P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P32971 |
Synonym | CD153 CD153 antigen CD30 antigen ligand CD30 L CD30 ligand CD30-L CD30L CD30LG MGC138144 TNFL8_HUMAN Tnfsf8 Tumor necrosis factor (ligand) superfamily member 8 Tumor necrosis factor ligand superfamily member 8 |
Description | Recombinant Human CD30L Protein (denatured) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSQRTDSIPNSPDNVPLKGGNCSEDLLCI LKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLY FIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQN LSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Molecular Weight | 22 kDa including tags |
Purity | >80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. |
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References |
Gene Functions References
- circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID: 24447865
- TNFSF8 is an important leprosy T1R susceptibility gene. PMID: 25320285
- The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID: 24676358
- The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID: 22033252
- Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID: 21480186
- a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID: 21292647
- capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID: 11728464
- Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID: 16964309
- CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID: 19208589
- Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID: 19657367