Recombinant Human CD32A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10970P
Recombinant Human CD32A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10970P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P12318 |
Synonym | CD32 CD32 antigen CDw32 Fc fragment of IgG, low affinity IIa, receptor (CD32) Fc fragment of IgG, low affinity IIa, receptor for (CD32) Fc gamma RII a Fc gamma RIIa Fc-gamma RII-a Fc-gamma-RIIa FCG2 FCG2A_HUMAN FcGR FCGR2 FCGR2A FCGR2A1 FcRII a FcRII-a IGFR2 IgG Fc receptor II a IgG Fc receptor II-a Immunoglobulin G Fc receptor II low affinity immunoglobulin gamma Fc region receptor II a Low affinity immunoglobulin gamma Fc region receptor II-a |
Description | Recombinant Human CD32A Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SDSIQWFHNGNLI PTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLE FQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHS GDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIV AAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYE TADGGYMTLNPRAPTDDDKNIYLTLPPN |
Molecular Weight | 35 kDa including tags |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |