Recombinant Human CD34 Protein
Beta LifeScience
SKU/CAT #: BLA-10979P
Recombinant Human CD34 Protein
Beta LifeScience
SKU/CAT #: BLA-10979P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P28906 |
Synonym | CD34 CD34 antigen CD34 molecule CD34_HUMAN Cluster designation 34 cluster of differentiation 34 Hematopoietic progenitor cell antigen CD34 HPCA1 Mucosialin OTTHUMP00000034733 OTTHUMP00000034734 |
Description | Recombinant Human CD34 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSLDNNGTATPELPTQGTFSNV STNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSV YGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTS LATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEF KKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTE ISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT |
Molecular Weight | 31 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |