Recombinant Human CD37 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10984P
Recombinant Human CD37 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10984P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P11049 |
Synonym | CD 37 CD37 CD37 antigen CD37 molecule CD37_HUMAN Cell differentiation antigen 37 GP52 40 Leukocyte antigen CD37 Leukocyte surface antigen CD37 MGC120234 Tetraspanin 26 Tetraspanin-26 Tetraspanin26 TSPAN 26 Tspan-26 TSPAN26 |
Description | Recombinant Human CD37 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | AQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWF QVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRH SADICAVPAESHIYREGCAQGLQKWLHN |
Molecular Weight | 42 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |