Recombinant Human CD38 Protein

Beta LifeScience SKU/CAT #: BLA-10986P

Recombinant Human CD38 Protein

Beta LifeScience SKU/CAT #: BLA-10986P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P28907
Synonym Acute lymphoblastic leukemia cells antigen CD38 ADP ribosyl cyclase ADP ribosyl cyclase 1 ADP ribosyl cyclase/cyclic ADP-ribose hydrolase ADP-ribosyl cyclase 1 ADPRC 1 ADPRC1 cADPr hydrolase 1 CD 38 CD38 CD38 antigen CD38 antigen (p45) CD38 molecule Cd38-rs1 CD38_HUMAN CD38H Cyclic ADP ribose hydrolase Cyclic ADP ribose hydrolase 1 Cyclic ADP-ribose hydrolase 1 EC 3.2.2.5 Ecto nicotinamide adenine dinucleotide glycohydrolase I-19 I19 (mouse) Lymphocyte differentiation antigen CD38 NAD(+) nucleosidase NIM-R5 antigen NIMR5 antigen (mouse) OTTHUMP00000158633 OTTHUMP00000217743 p45 T10
Description Recombinant Human CD38 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGA FISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDM FTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTV SRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWV IHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPE DSSCTSEI
Molecular Weight 31 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Add CD38 enzyme to 50 μl reaction mix containing NGD+ (Nicotinamide Guanine Dinucleotide). Incubate 4 min at room temperature. Read fluorescence (exc=300 nm, em=410 nm).
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
Subcellular Location Membrane; Single-pass type II membrane protein.
Protein Families ADP-ribosyl cyclase family
Database References
Tissue Specificity Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.

Gene Functions References

  1. CD38 and cADPR are key players in the orches- tration of cellular responses to respiratory syncytial virus by infected monocyte-derived dendritic cells. PMID: 29178427
  2. our data are consistent with the conclusion that CD38 plays a role in murine and human lung tumorigenesis PMID: 29228209
  3. isatuximab decreases multiple myeloma cell- and bone marrow stromal cell-induced iTreg by inhibiting both cell-cell contact and TGFbeta/IL10. Finally, CD38 levels correlate with differential inhibition by isatuximab of Tregs from multiple myeloma versus normal donors.Targeting CD38 by isatuximab can preferentially block immunosuppressive Tregs and thereby restore immune effector function against multiple myeloma PMID: 28249894
  4. Empathic response mediates the CD38-altruism association. PMID: 28865941
  5. Increased levels of HLADR and CD38 expressions in peripheral blood were associated with oral lesions in HIV-positive patients. Periodontal disease was associated with HLADR expression. PMID: 28500735
  6. Panobinostat increased CD38 expression in a dose-dependent manner in primary myeloma cells. This was specific for myeloma cells and did not occur in lymphoma cell lines. This increase enabled the antimyeloma activity of daratumumab. PMID: 28476749
  7. To demonstrate the therapeutic effect of daratumumab in CLL, we generated a disseminated CLL mouse model with the CD38(+) MEC2 cell line and CLL patient-derived xenografts (CLL-PDX). Daratumumab significantly prolonged overall survival of MEC2 mice, completely eliminated cells from the infiltrated organs, and significantly reduced disease burden in the spleen of CLL-PDX PMID: 27637890
  8. CD38 mRNA levels were correlated with lower Autism Quotient (AQ), indicating enhanced social skills. CD38 expression and CD157 eQTL SNPs altogether account for a substantial 14% of the variance in sociality. the ecological validity of these findings was demonstrated with subjects with higher PBL CD38 expression having more friends, especially for males. PMID: 28212520
  9. CD38(lo) luminal cells are enriched in glands adjacent to inflammatory cells and exhibit epithelial nuclear factor kappaB (NF-kappaB) signaling. In response to oncogenic transformation, CD38(lo) luminal cells can initiate human prostate cancer in an in vivo tissue-regeneration assay PMID: 27926864
  10. Results provide evidence that CD38 enhanced the proliferation and inhibited the apoptosis of cervical cancer cells by affecting the mitochondria functions. PMID: 28544069
  11. these data demonstrate an important role for CD38 and complement-inhibitory protein expression levels in daratumumab sensitivity. PMID: 27307294
  12. Results may imply that CD38 expression either reflects or participates in pathogenic mechanisms of HIV disease independently of cell cycling. PMID: 27064238
  13. The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring. PMID: 26306999
  14. Primary human melanoma cell lines suppress in vitro T cell proliferation through an adenosinergic pathway in which CD38 and CD73 play a prominent role. PMID: 26329660
  15. CD38 and its related genes are highly expressed in human nasopharyngeal carcinoma cell lines. PMID: 25630761
  16. soluble CD38 (sCD38) in seminal plasma increases the capacitation of sperm via specific interactions between sCD38 and the CD31 on the sperm. PMID: 26407101
  17. the expression of CD38+ on both CD4+, CD8+T lymphocytes from peripheral blood and CSF discriminated between viremic and non-viremic patients PMID: 26365593
  18. study points to an association between maternal SNPs in the CD38 in Japanese women and susceptibility to preterm birth. PMID: 26025338
  19. Peripheral blood CD38 bright CD8+ effector memory T cells predict acute graft-versus-host disease. PMID: 25881755
  20. CD38 is expressed on human MDSC-like cell population that is expanded in the peripheral blood of advanced-stage cancer patients. PMID: 26294209
  21. Upregulation of CD38 expression on multiple myeloma cells by all-trans retinoic acid improves the efficacy of daratumumab. PMID: 25975191
  22. Genetic variation in CD38 and breastfeeding experience interact to impact infants' attention to social eye cues. PMID: 26371313
  23. genetic polymorphism is associated with diffuse large B-cell lymphoma susceptibility in Egyptians PMID: 25564959
  24. Hairy-cell leukemia patients that were CD38-positive had a shorter mean time to salvage therapy than CD38-negative ones. CD38 expression in HCL drives poor prognosis by promoting survival and heterotypic adhesion. PMID: 26170397
  25. alterations in content of soluble molecules CD38 are associated with characteristics of tumor process that indicates at their monitoring significance under malignant neoplasms of uterus PMID: 26470437
  26. The results indicate that the net charge of the N-terminal segment is important in determining the membrane topology of CD38 and that the type III orientation can be a functional form of CD38 for Ca(2)-signaling. PMID: 25447548
  27. The majority of extranodal NK/T cell lymphoma cases were CD38 positive, which significantly correlated with poor outcomes. PMID: 25865943
  28. High levels of CD38 reduced intracellular (NAD+) levels and blocked acquired resistance by inhibiting the activity of the NAD+-dependent SIRT1 deacetylase PMID: 24967705
  29. CD38 status was associated with behavior and psychological reactions within live interactions, as well as global relationship quality PMID: 24396004
  30. These results validate CD38 as a therapeutic target and support the current evaluation of this unique CD38-targeting functional antibody in phase I clinical trials in patients with CD38+ B-cell malignancies. PMID: 24987056
  31. At the same time, CD38 overexpression affected the expression of PI3K, Akt, MDM2 and p53 in vivo PMID: 25310288
  32. CD38 expression is regulated by micro-RNA 708 in airway smooth muscle cells. PMID: 25175907
  33. CD38 has a role in chronic lymphocytic leukemia growth and trafficking PMID: 24990614
  34. Chronic lymphocytic leukemia cells express CD38 in response to Th1 cell-derived IFN-gamma by a T-bet-dependent mechanism. PMID: 25505279
  35. Increased numbers of circulating ICOS(+) and IL-21(+) Tfh and CD38(+) plasma cells may be exhibited by patients with recent diagnoses of primary biliary cirrhosis. PMID: 25404409
  36. nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38 PMID: 24635660
  37. Autism and features of regression-previously acquired speech lost in the second year of life. The younger sister, who also had asthma, inherited a maternal deletion of 4p15.32 that results in a BST1-CD38 fusion transcript. PMID: 24634087
  38. results demonstrate that CD38(+) cells are a useful model to study effects of the cellular NAD levels on cellular processes and establish a new linker between cellular NAD levels and oxidative stress PMID: 24295520
  39. only one SNP in CD38 was significantly associated with social integration and that SNP predicted when using a dichotomized indicator of social connectedness, but not a continuous measure of social connectedness or the continuously married outcome. PMID: 24209975
  40. Data suggest that the uniquely increased expression of CD38 and E2F2 in rheumatoid arthritis (RA) synovial tissues contribute to the immunoactivation of the disease. PMID: 24397353
  41. PBMC from MM patients display a deregulated response related to CD38 activation pathway defects; CD38 may be functionally involved in the progression of this pathology via the secretion of high levels of IL-6 that protects neoplastic cells from apoptosis PMID: 24489445
  42. These data suggest that both functional roles of CD38 might be important in the pathogenesis of B-CLL. PMID: 24216102
  43. Atorvastatin and rosiglitazone did not affect the expression of CD38. PMID: 23686733
  44. Data suggest CD38 (CD38 antigen (p45) protein) and CD49d (alpha4 Integrin; very late antigen-4 alpha) are more than just markers of an aggressive chronic lymphocytic leukemia (CLL) cell type and play functional roles in pathobiology of CLL. [REVIEW] PMID: 24288111
  45. CD38 is expressed within caveolae and its function is linked to the caveolar regulatory proteins. PMID: 24275509
  46. Report diagnosis of multiple myeloma using two-color flow cytometry based on kappa/lambda ratios of CD38-gated plasma cells. PMID: 23755763
  47. CD38-cADPR mediates bile acid-induced pancreatitis and acinar cell injury through aberrant intracellular Ca(2+) signaling. PMID: 23940051
  48. The frequency of CD38high antibody-secreting cells (ASCs) is increased during the acute phase of hepatitis A virus (HAV) infection. Substantial numbers of ASCs are non-HAV-specific and dominantly secrete IgM. PMID: 23729443
  49. Data show that ADP-ribosylation of CtBP1-S/BARS by brefeldin A (BFA) occurs via synthesis of a BFA-ADP-ribose conjugate by the ADP-ribosyl cyclase CD38 and covalent binding of the BFA-ADP-ribose conjugate into the CtBP1-S/BARS NAD(+)-binding pocket. PMID: 23716697
  50. CD38 signals upregulate expression and functions of matrix metalloproteinase-9 in chronic lymphocytic leukemia cells. PMID: 22955446

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed