Recombinant Human CD4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11002P
Recombinant Human CD4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11002P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P01730 |
Synonym | CD 4 CD4 CD4 (L3T4) CD4 antigen CD4 antigen (p55) CD4 molecule CD4 receptor CD4+ Lymphocyte deficiency, included CD4_HUMAN CD4mut L3T4 Leu3 Ly-4 Lymphocyte antigen CD4 MGC165891 OTTHUMP00000238897 p55 T cell antigen T4 T cell antigen T4/LEU3 T cell differentiation antigen L3T4 T cell OKT4 deficiency, included T cell surface antigen T4/Leu 3 T cell surface antigen T4/Leu3 T cell surface glycoprotein CD4 T-cell surface antigen T4/Leu-3 T-cell surface glycoprotein CD4 W3/25 W3/25 antigen |
Description | Recombinant Human CD4 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGL TANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPL AFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMG KKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDS GQVLLESNIKVLPTWSTPVQPHHHHHH |
Molecular Weight | 42 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |