Recombinant Human CD45 Protein
Beta LifeScience
SKU/CAT #: BLA-11015P
Recombinant Human CD45 Protein
Beta LifeScience
SKU/CAT #: BLA-11015P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | B220 CD 45 CD45 CD45 antigen CD45R GP180 L-CA LCA Leukocyte common antigen loc Ly-5 LY5 Ly5, homolog of Lyt-4 OTTHUMP00000033813 OTTHUMP00000033816 OTTHUMP00000033817 OTTHUMP00000038574 Protein tyrosine phosphatase receptor type c polypeptide Protein tyrosine phosphatase, receptor type C protein tyrosine phosphatase, receptor type, C Protein tyrosine phosphatase, receptor type, c polypeptide Ptprc PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C T200 T200 glycoprotein T200 leukocyte common antigen |
Description | Recombinant Human CD45 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNL IKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNM TVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRV KDLQYSTDYTFKAYFHNGDYPGEPFILHHST |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |