Recombinant Human CD45 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11020P
Recombinant Human CD45 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11020P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P08575 |
Synonym | B220 CD 45 CD45 CD45 antigen CD45R GP180 L-CA LCA Leukocyte common antigen loc Ly-5 LY5 Ly5, homolog of Lyt-4 OTTHUMP00000033813 OTTHUMP00000033816 OTTHUMP00000033817 OTTHUMP00000038574 Protein tyrosine phosphatase receptor type c polypeptide Protein tyrosine phosphatase, receptor type C protein tyrosine phosphatase, receptor type, C Protein tyrosine phosphatase, receptor type, c polypeptide Ptprc PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C T200 T200 glycoprotein T200 leukocyte common antigen |
Description | Recombinant Human CD45 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTS LSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQ TFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHH SSAALPARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSK PTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTE CKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKW KNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNN HKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLC YIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAM CHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAG NTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYN SK |
Molecular Weight | 147 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity.; (Microbial infection) Acts as a receptor for human cytomegalovirus protein UL11 and mediates binding of UL11 to T-cells, leading to reduced induction of tyrosine phosphorylation of multiple signaling proteins upon T-cell receptor stimulation and impaired T-cell proliferation. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Membrane raft. |
Protein Families | Protein-tyrosine phosphatase family, Receptor class 1/6 subfamily |
Database References | |
Associated Diseases | Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID); Multiple sclerosis (MS) |
Tissue Specificity | Isoform 1: Detected in thymocytes. Isoform 2: Detected in thymocytes. Isoform 3: Detected in thymocytes. Isoform 4: Not detected in thymocytes. Isoform 5: Detected in thymocytes. Isoform 6: Not detected in thymocytes. Isoform 7: Detected in thymocytes. Is |
Gene Functions References
- Overall, this study reveals the heterogeneity of CD4 effector memory T cells expressing CD45RA and provides insights into T-cell responses against dengue virus and other viral pathogens. PMID: 29133794
- Five-year disease-free survival for patients with a high transcriptional expression of CD45 (n = 107) was 62.4% and for patients with a low expression (n = 53) it was 36.2% (P = 0.003). Patients with a high expression of CD45 had a better local recurrence-free survival and disease-specific survival. PMID: 29177949
- CD45 is a regulator of IL-2 synergy in the NKG2D-mediated activation of immature human NK cells PMID: 28655861
- TCR phosphorylation negatively correlates with TCR-CD45 separation. PMID: 29467364
- Our results demonstrate that the expression of CD163 and CD206 in monocytes is modulated by LPS in vitro; LPS induces CD163 expression and downregulates the spontaneously increased expression of CD206 PMID: 25914252
- Our results show that the kinetic strategy used in this study may be a simple and easy approach to assess by RT-FCM the reaction between NO and superoxide ion in whole blood monocytes..The no-wash, no-lyse staining protocol with CD45-KO and CD14-PB allows to differentiate clearly and to gate in the monocyte population in near-physiological conditions PMID: 25758468
- regulatory effect of the mannose receptor (MR) was mediated by a direct interaction with CD45 on the T cell, inhibiting its phosphatase activity, which resulted in up-regulation of CTLA-4 and the induction of T-cell tolerance. Inhibition of CD45 prevented expression of B-cell lymphoma 6 (Bcl-6), a transcriptional inhibitor that directly bound the CTLA-4 promoter and regulated its activity PMID: 27601670
- pUL11 induces IL-10 producing T cells as a result of pUL11 binding to the CD45 phosphatase on T cells. PMID: 28628650
- Expression of IL10R subunits within the leukocyte population (CD45(+) cells) was significantly higher in primary brain tumors than in metastases. PMID: 28982901
- As CD45 expression vs. SSc is routinely measured in the diagnostics of acute leukemias. PMID: 26415521
- A phosphosite within the SH2 Domain of Lck regulates its activation by CD45. A negative feedback loop that responds to signaling events tunes active Lck amounts and TCR sensitivity. PMID: 28735895
- C77G is not associated with ovarian cancer in the Norwegian population. However, it is possibly associated with a less aggressive cancer type. PMID: 28759630
- Our findings suggest that CD45 is a key regulator of BCR-signaling thresholds mediated by T-cell help PMID: 27056269
- we demonstrate for the first time the physiological existence of ct-CD45 in human plasma and show that it may be an extrinsic factor contributing to the maintenance of human T-cell quiescence. PMID: 27718235
- Our findings suggest that if w/h ratio on SSC versus CD45 plot is less than 1.6, AML may be considered, and if it is more than 1.6, ALL may be diagnosed. Using morphometric analysis of the blast cluster on SSC versus CD45, it was possible to distinguish between ALL and AML, and their subtypes. PMID: 27748273
- Use of the common leukocyte marker CD45 increases the sensitivity of the diagnosis of lymphocytic myocarditis. PMID: 28025077
- Review/Meta-analysis: Rheumatoid arthritis patients with PTPRC rs10919563 A allele show a poor response to anti-TNF therapy. PMID: 27074847
- Data suggest that CD41 and CD45 expression marked the onset of haemangioblastoma (HB) neovascularisation and the stepwise development of the angioformative period, and also the underlying therapeutic targets of anti-vascular treatment. PMID: 26468019
- PTPRC has become the most replicated genetic biomarker of response to TNF inhibitors PMID: 25896535
- CD45RO in tumor-infiltrating lymphocytes was found to be a positive prognostic factor in squamous non-small cell lung cancer. PMID: 26678911
- CD45RO+ memory T-cells produce IL-17 in patients with atherosclerosis. PMID: 26667768
- Data show the structural basis for, and the potent signaling effects of, local CD45 antigen and kinase segregation. PMID: 26998761
- a CD45+/CD19 - cell population in bone marrow aspirates correlated with the clinical outcome of patients with mantle cell lymphoma. PMID: 25739938
- High CD45 expression is associated with multiple myeloma. PMID: 26994849
- C77G T(reg) showed diminished upregulation of activation markers, lower phosphorylation of p56(lck)(Y505) and a reduced proliferative potential when stimulated with anti-TcR or anti-TcR plus CD28 mAb suggesting decreased responsiveness to activating stimuli. Data suggest that the changes in CD45 isoform combination resulting from the C77G mutation alter the responsiveness PMID: 26355564
- Findings indicate that CD45 antigen(+) and c-Kit protein(+) hematopoietic cells were more abundant in muscle than in bone marrow between embryonic 14.5 and 17.5 days. PMID: 26389592
- CD4+CD45RO+CD25-/lowCD127+: CD4+CD45RO+CD25hiCD127-/low ratio in peripheral blood indicates heart transplant recipients at risk for cardiac allograft vasculopathy. PMID: 25539460
- CD45+ cells were abundant in the stroma of physiologically immature placental villi and decreased as pregnancy progressed. PMID: 25043745
- This study demonstrated that the copy number variations of PTPRC relate to opioid dependence. PMID: 25345593
- This study did not replicate the association between PTPRC and the response to anti-TNF treatment in our Southern European population. We found that TRAF1/C5 risk RA variants potentially influence anti-TNF treatment response. PMID: 25834819
- long noncoding RNA encoded by the natural antisense gene of CD45 contributes to the expressional regulation of the CD45RO splicing variant via recruitment of DNA methyltransferase and histone modification modulators specific to the sense gene CD45 PMID: 25381328
- In T-cells, cholesterol-dependent domains function in the regulation of the Src family kinase Lck (p56lck) by sequestering Lck from its activator CD45. (Review) PMID: 25658353
- Patients with the presence of CD8- and CD45RO-positive T cells in bone marrow demonstrated better survival of gastric cancer patients than those with the absence of these cells in bone marrow. PMID: 25804232
- Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease. PMID: 25421756
- Late-outgrowth CD45 negative endothelial progenitor cells express markers associated with pluripotency and can directly express an osteogenic phenotype under bone differentiation conditions. PMID: 25531767
- SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells PMID: 25312647
- Phosphatase CD45 both positively and negatively regulates T cell receptor phosphorylation in reconstituted membrane protein clusters, depending on LCK activity. PMID: 25128530
- Results show that CD45 PTP activity is inhibited by galectin-1 in anaplastic large cell lymphoma cell line H-ALCL. PMID: 24589677
- Expressing CD45 promoters containing these regions and tethered to green fluorescent protein (GFP) in a primary B-cell differentiation assay and a transplantation model resulted in high levels of GFP in lymphoid, myeloid, and nucleated erythroid cells PMID: 24852660
- The rare sub-population of CD45(-)/Lin(-)/SSEA-4(+) VSEL stem cells survived after Hespan sedimentation. PMID: 24364909
- Hematopoietic cell marker CD45 is expressed in hepatic progenitor cells. PMID: 24396288
- CD45RA-Foxp3high Tregs increase in the peripheral circulation of head and neck squamous cell carcinoma patients. PMID: 24761979
- the regulation of alternative splicing in CD45 by IkappaBL was independent from the kinase activity of CLK1. PMID: 23953137
- high CD45 surface expression is associated with a poor prognosis in BCP-ALL as well as in T-ALL. PMID: 23911702
- PTPRC/CD45 is down-regulated in leukemogenic tyrosine kinase expressing cells. PMID: 23997015
- [review] Circulating CD34+/KDR+/CD45dim endothelial progenitor cells have great potential as biomarkers of vasculogenesis and endothelial repair wjen research protocols of in vitro culture and flow cytometry are included. PMID: 23171577
- Heterogeneity within the Lin(-)CD45(-) cell fraction is the likely explanation for differences in the hUCB cell populations. PMID: 23840798
- Galectin-3-induced apoptosis of Jurkat cells is regulated by both O-glycans and N-glycans on CD45. PMID: 24211831
- spatial regulation of Lck by CD45 and GM1 ganglioside determines the outcome of apoptotic response to Gal-1 and this local regulation may occur only upon intimate effector (Gal-1 expressing) cell-T-cell attachment. PMID: 24231767
- A glycosylation-dependent CD45RB epitope defines previously unacknowledged CD27-(IgM high) B cell subpopulations enriched in young children and after hematopoietic stem cell transplantation. PMID: 24211716