Recombinant Human CD52 Protein (Fc Tag His Tag)

Name: Recombinant Human CD52 Protein (Fc Tag His Tag)
Brand: Beta LifeScience
SKU: BLA-11025P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P31358
Synonym	Cambridge pathology 1 antigen CAMPATH 1 CAMPATH 1 antigen CAMPATH-1 antigen CD 52 CD52 CD52 antigen CD52 molecule CD52_HUMAN CDw52 CDW52 antigen Epididymal secretory protein E5 Epididymis secretory sperm binding protein Li 171mP HE 5 He5 Human epididymis-specific protein 5
Description	Recombinant Human CD52 Protein (Fc Tag His Tag) was expressed in Baculovirus infected insect cells. It is a Full length protein
Source	Baculovirus infected insect cells
AA Sequence	GQNDTSQTSSPSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHH H
Molecular Weight	28 kDa including tags
Purity	>95% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Database References	HGNC: 1804 OMIM: 114280 KEGG: hsa:1043 STRING: 9606.ENSP00000363330 UniGene: Hs.276770

Gene Functions References

soluble CD52 exerts a concerted immunosuppressive effect by first sequestering HMGB1 to nullify its proinflammatory Box B, followed by binding to the inhibitory Siglec-10 receptor, triggering recruitment of SHP1 to the intracellular immunoreceptor tyrosine-based inhibitory motif of Siglec-10 and its interaction with the TCR. PMID: 29997173
CD52 is a novel prognostic NSC marker and a potential NSC target in a subset of patients with MDS and AML, which may have clinical implications and may explain clinical effects produced by alemtuzumab in these patients. PMID: 24799522
carbohydrate moiety of sperm protein interferes with the complement system via binding to C1q PMID: 22386526
CT60 single-nucleotide polymorphism of CTLA4 is a surrogate marker for donor lymphocyte infusion outcome after allogeneic cell transplantation for acute leukemia PMID: 21552305
Clonal large granular lymphocytes exhibited decreased CD52 expression post-therapy in patients refractory to treatment. PMID: 19794084
Our bioinformatics findings suggest that CD52 polymorphism may affect the efficiency of GPI anchor formation and thus may indirectly alter the response to anti-CD52 agents like alemtuzumabin renal transplantation. PMID: 20349607
Review article on CD52 structure and function. PMID: 11860230
HE5(CD52) mRNA and protein, expressed in epithelial cells of the distal epididymis, were not affected by the obstruction of the vas deferens. PMID: 14662784
The relationship between this differential insertion and differences in glycosylation of rat and human CD52 is discussed. PMID: 16266689
CD52 is widely expressed on human mast cells (MCs) and Waldenstrom's Macroglobulinemia bone marrow lymphoplasmacytic cells and provide the preclinical rationale for the use of alemtuzumab in the treatment of WM and possibly other MC-related disorders. PMID: 16796779
In this study, we identified the antigen of 4C8 mAb as CD52. CD52 is a costimulatory molecule for induction of CD4-positive T cells. PMID: 16797237
In contrast with CLL, the variable expression of CD52 among other hematologic malignancies suggests that target validation on a case-by-case basis will likely be necessary to guide the rational analysis of CAMPATH therapy. PMID: 17145843
Our data demonstrate differences in the intensity of the CD52 antigen expression between B-lymphocytes and tumor lymphocytes of B-CLL patients, and between B-CLL and SLL tumor cells. CD52 antigen is expressed at low level on CD34(+) cells. PMID: 17428002
The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen. PMID: 17624925
We first showed the expression of CD52 in human cumulus cells. CD52 has some functional roles around fertilization in females as well as in males. PMID: 18647288
A review on CD52 expression and function PMID: 11257744

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.