Recombinant Human CD6/T12 Protein
Beta LifeScience
SKU/CAT #: BLA-11041P
Recombinant Human CD6/T12 Protein
Beta LifeScience
SKU/CAT #: BLA-11041P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P30203 |
Synonym | CD_antigen=CD6 CD6 CD6 antigen Tp120 CD6 molecule CD6_HUMAN FLJ44171 OX52 T cell differentiation antigen CD6 T-cell differentiation antigen CD6 T12 TP120 |
Description | Recombinant Human CD6/T12 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAAR VLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM |
Molecular Weight | 36 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |