Recombinant Human CD62L Protein
Beta LifeScience
SKU/CAT #: BLA-11048P
Recombinant Human CD62L Protein
Beta LifeScience
SKU/CAT #: BLA-11048P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P14151 |
Synonym | A.11 AI528707 CD62 antigen ligand CD62 antigen-like family member L CD62L gp90-MEL IgA nephropathy, susceptibility to, included L Selectin L-selectin LAM-1 LAM1 LECAM1 LEU8 Leukocyte adhesion molecule 1 Leukocyte surface antigen Leu-8 Leukocyte-endothelial cell adhesion molecule 1 Lnhr LSEL Ly-22 Ly-m22 Lyam-1 LYAM1 LYAM1_HUMAN Lymph node homing receptor Lymphocyte adhesion molecule 1 Lymphocyte antigen 22 Lymphocyte surface MEL-14 antigen MEL-14 Pln homing receptor PLNHR Selectin L Selectin, lymphocyte SELL TQ1 |
Description | Recombinant Human CD62L Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGEFLCCDFLAHHGTDCWTYHYSEKP MNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGI WTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDAC HKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQC EPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNW SSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIG KKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN |
Molecular Weight | 38 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |