Recombinant Human CD66b Protein
Beta LifeScience
SKU/CAT #: BLA-11054P
Recombinant Human CD66b Protein
Beta LifeScience
SKU/CAT #: BLA-11054P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P31997 |
Synonym | Carcinoembryonic antigen CGM6 Carcinoembryonic antigen gene family member 6 Carcinoembryonic antigen related cell adhesion molecule 8 Carcinoembryonic antigen-related cell adhesion molecule 8 CD 66b CD 67 CD66b CD66b antigen CD67 CD67 antigen CEACAM 8 CEACAM8 CEAM8_HUMAN CGM 6 CGM6 NCA 95 NCA95 Non-specific cross-reacting antigen NCA-95 Nonspecific cross reacting antigen NCA 95 Nonspecific cross reacting antigen NCA95 |
Description | Recombinant Human CD66b Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVI SNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEV TGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQS LPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVL YGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKL FIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS |
Molecular Weight | 33 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner. Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Cell surface. |
Protein Families | Immunoglobulin superfamily, CEA family |
Database References | |
Tissue Specificity | Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. |
Gene Functions References
- Increased CD66b positive tumor-infiltrating neutrophils (CD66b + TINs) was significantly associated with presence of metastasis, S stage, and nonseminomatous germ cell tumor diagnosis. PMID: 27863478
- Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another. PMID: 26483485
- Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls. PMID: 23686079
- The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation. PMID: 21470677
- All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes. PMID: 17909799
- CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b. PMID: 18056392