Recombinant Human CD68 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-11056P
Recombinant Human CD68 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-11056P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P34810 |
Synonym | CD 68 CD68 CD68 antigen CD68 molecule CD68_HUMAN DKFZp686M18236 gp11 Gp110 LAMP4 MACROPHAGE ANTIGEN CD68 Macrophage antigen CD68 (microsialin) Macrosialin SCARD1 Scavenger receptor class D member 1 |
Description | Recombinant Human CD68 Protein (Fc Tag Active) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTS HGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATV HPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVH LQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG HLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPL GQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA assay. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |