Recombinant Human CD68 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11057P
Recombinant Human CD68 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11057P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P34810 |
Synonym | CD 68 CD68 CD68 antigen CD68 molecule CD68_HUMAN DKFZp686M18236 gp11 Gp110 LAMP4 MACROPHAGE ANTIGEN CD68 Macrophage antigen CD68 (microsialin) Macrosialin SCARD1 Scavenger receptor class D member 1 |
Description | Recombinant Human CD68 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | ADPNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTG TTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGN ATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQP CVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSF PYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQ APLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDR SHHHHHH |
Molecular Weight | 33 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |