Recombinant Human CD79b Protein
Beta LifeScience
SKU/CAT #: BLA-11075P
Recombinant Human CD79b Protein
Beta LifeScience
SKU/CAT #: BLA-11075P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P40259 |
Synonym | AGM6 B cell antigen receptor complex associated protein beta chain B cell specific glycoprotein B29 B-cell antigen receptor complex-associated protein beta chain B-cell-specific glycoprotein B29 B29 B29/Ig-beta/CD79b CD 79b CD79b CD79b antigen CD79b antigen (immunoglobulin associated beta) CD79b molecule CD79b molecule immunoglobulin associated beta CD79b protein CD79B_HUMAN Ig beta Ig-beta IGB Igbeta Immunoglobulin associated B29 Immunoglobulin associated B29 protein Immunoglobulin associated beta Immunoglobulin associated protein Immunoglobulin-associated B29 protein MGC108607 |
Description | Recombinant Human CD79b Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLW KQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNN TSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH |
Molecular Weight | 15 kDa |
Purity | >95% SDS-PAGE.Lyophilized from a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |