Recombinant Human CD8 beta/CD8B Protein
Beta LifeScience
SKU/CAT #: BLA-11081P
Recombinant Human CD8 beta/CD8B Protein
Beta LifeScience
SKU/CAT #: BLA-11081P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P10966 |
Synonym | CD8b antigen CD8 antigen beta polypeptide 1 CD8 antigen beta polypeptide 1 (p37) CD8 beta CD8b CD8b molecule CD8B_HUMAN CD8B1 Leu2 Ly3 LYT3 MGC119115 P37 T cell surface glycoprotein CD8 beta chain T lymphocyte surface glycoprotein beta chain T-cell surface glycoprotein CD8 beta chain |
Description | Recombinant Human CD8 beta/CD8B Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLA LWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGS PELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPV DHHHHHH |
Molecular Weight | 18 kDa including tags |
Purity | >95% SDS-PAGE.Purityis greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |