Recombinant Human CD80 Protein (Fc Tag) (Biotin)

Beta LifeScience SKU/CAT #: BLA-11089P

Recombinant Human CD80 Protein (Fc Tag) (Biotin)

Beta LifeScience SKU/CAT #: BLA-11089P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P33681
Synonym Activation B7-1 antigen B lymphocyte activation antigen B7 B7 B7-1 B7-1 antigen B7.1 BB1 CD28 antigen ligand 1 CD28LG CD28LG1 CD80 CD80 antigen CD80 antigen (CD28 antigen ligand 1, B7-1 antigen) CD80 molecule CD80_HUMAN Costimulatory factor CD80 costimulatory molecule variant IgV-CD80 CTLA-4 counter-receptor B7.1 LAB7 T-lymphocyte activation antigen CD80
Description Recombinant Human CD80 Protein (Fc Tag) (Biotin) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIW PEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEV TLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNA INTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTT KQEHFPDNIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGLN DIFEAQKIEWHE
Molecular Weight 53 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.; (Microbial infection) Acts as a receptor for adenovirus subgroup B.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References
Tissue Specificity Expressed on activated B-cells, macrophages and dendritic cells.

Gene Functions References

  1. Addition of TNFalpha to podocytes causes CD80 upregulation, actin reorganization and podocyte injury. PMID: 29022109
  2. Urinary CD80 levels were significantly higher in the children with minimal change disease than in the controls and patients with other causes of nephrotic syndrome. PMID: 29507273
  3. Results showed novel genetic associations with bone phenotypes and points to the CD80 gene as relevant in postmenopausal bone loss. PMID: 28466138
  4. Increased expressions of TLR-3, TLR-4 and CD80 mRNA and the level of urinary CD80/creatinine could be useful markers to differentiate patients of steroid-sensitive nephrotic syndrome in relapse from those with steroid-resistant nephrotic syndrome. PMID: 28210837
  5. The rs1915087 (C>T), rs6804441 (A>G) and rs41271391 (G>T) of B7 antigens were suspected as the factors associated with reduced risk of recurrent spontaneous abortion. PMID: 29069644
  6. Tregs were observed to regulate CD4(+), but not CD8(+), T cell infiltration into tumors through a CTLA-4/CD80 dependent mechanism. Disrupting CTLA-4 interaction with CD80 was sufficient to induce CD4 T cell infiltration into tumors. PMID: 28856392
  7. Results show that CD80 down-regulation is associated to aberrant DNA methylation in dysplasia of sporadic colonic carcinogenesis. This study indicates that the failure of immune surveillance mechanisms in non-inflammatory colon carcinogenesis may be linked to genomic methylation directly or indirectly affecting CD80 expression. PMID: 27377375
  8. Fabry disease is characterized by early occurrence of increased uCD80 excretion that appears to be a consequence of glycolipid accumulation. PMID: 27733175
  9. CTLA-4(+) microvesicles can competitively bind B7 costimulatory molecules on bystander dendritic cells, resulting in downregulation of B7 surface expression. PMID: 26979751
  10. The expression of B7-H6 is up-regulated in U87-derived glioma stem like cells. PMID: 27609569
  11. PD-1 receptor has a role in interacting with programmed cell death ligands and B7-1 PMID: 28270509
  12. CD80-QPAR platform provides a useful predictive model for unknown RA extract's bioactivities using the chemical fingerprint inputs PMID: 28337449
  13. this study shows that dendritic cells from rheumatoid arthritis patients have low expression levels of CD80 PMID: 27421624
  14. B7-1 is not expressed by podocytes in LN. A renoprotective effect of B7-1 blockade in LN patients cannot be ruled out but, if confirmed, cannot be the result of an effect on podocyte B7-1 PMID: 27198457
  15. analysis of CTLA4-Ig in B7-1-positive diabetic and non-diabetic kidney disease [review] PMID: 26409459
  16. Genetic interaction of CD80 and ALOX5AP was observed in systemic lupus erythematosus in Asian populations. PMID: 25862617
  17. Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression PMID: 27065104
  18. Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2. PMID: 26561569
  19. B7-1 is not induced in podocytes from patients with minimal change disease or focal segmental glomerulosclerosis. PMID: 26697986
  20. In the present study, we investigated the prognostic significance of the expression of three genes in the PD-L1 pathway, including PD-L1, B7.1 and PD-1, in three independent bladder cancer datasets in the Gene Expression Omnibus database. PMID: 25963805
  21. SNP rs1599795 in CD80 3'-UTR, through disrupting the regulatory role of miR-132-3p, miR-212-3p, and miR-361-5p in CD80 expression, contributed to the occurrence of gastric cancer. PMID: 24981235
  22. Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD80. PMID: 24981893
  23. These findings reveal the distinct but complementary roles of CD80 and CD86 IgV and IgC domains in T cell activation. PMID: 24845157
  24. Expression of costimulatory molecules CD80/86 is an absolute requirement for efficient CD8 T cell priming by adenoviral vectors. PMID: 24951814
  25. Single-nucleotide polymorphisms in CD80 gene is associated with breast cancer risk after menopausal hormone replacement therapy. PMID: 24080446
  26. Data indicate that STAT5A and STAT5B transcription activator complex induces expression of CD80 gene. PMID: 24523507
  27. NOTCH1 protein regulates CD80/CD86-induced phosphatidylinositol 3-kinase signaling in interleukin-6 and indoleamine 2,3-dioxygenase production by dendritic cells PMID: 24415757
  28. lower expression on CD1c+ myeloid and CD303+ plasmacytoid DCs in pre-eclampsia PMID: 23773232
  29. No role in CD80 expression by podocytes was found for cytokines released by peripheral blood mononuclear cells PMID: 23689904
  30. Data indicate that low-dose decitabine (DAC) treatment can induce CD80 gene expression in a variety of cancer cells. PMID: 23671644
  31. These studies identify CD80-Fc as an alternative and potentially more efficacious therapeutic agent for overcoming PDL1-induced immune suppression and facilitating tumor-specific immunity PMID: 23918985
  32. Data indicate that the frequencies of CD11c, CD11c/CD86, HLA-DR/CD86, CD83 and CD80 were significantly high, while CD11c/HLA-DR was low in Hepatitis E infection. PMID: 23246582
  33. Lower expression of B7-1 and B7-2 proteins on peripheral monocytes in pre-eclampsia might indicate a secondary regulatory mechanism in response to the ongoing systemic maternal inflammation. PMID: 23289444
  34. he aim of this work was to analyse the interaction between early events in colonic ulcerative colitis-related and non-inflammatory carcinogenesis and CD80 expression to clarify what stimuli induce its up-regulation in these patients. PMID: 22704122
  35. mRNA expression analysis of B7-1 and NPHS1 in urinary sediment may be useful to differentiate between different histologic subtypes of glomerular kidney disease, particularly between minimal change disease and focal segmental glomerulosclerosis. PMID: 21414970
  36. Data suggest that expression of CD80, CD86, and CD40 on dendritic cells in normal endometrium is higher than on tumor infiltrating dendritic cells in endometrioid adenocarcinoma; this may reflect roles in antigen presentation/tumor escape. PMID: 22142817
  37. Data show that CD80 promoter and CD86 exon 8 allele frequencies vary significantly among populations of different ancestries. PMID: 22074996
  38. The interaction between PDL1 on antigen prresenting cells and B7.1 on T cells plays a dominant role in bidirectional interactions between these two molecules during alloimmune responses. PMID: 21697455
  39. the expression of the co-stimulatory molecule CD80 was decreased in intestines of celiac disease children after gluten-free diet. PMID: 21288140
  40. the costimulatory molecule CD80 prevents PDL1-mediated immune suppression by tumor cells and restores T cell activation PMID: 21555531
  41. Efficiency of GHA priming chemotherapy on refractory acute myeloid leukemia and myelodysplastic syndrome may be correlated with B7.1 expression. PMID: 18928583
  42. The low expression of CD80 and CD86 in thyroid papillary carcinoma may help them evade the immune system. PMID: 21469977
  43. study shows CTLA-4 can capture its ligands (CD80, CD86)from opposing cells by trans-endocytosis; data reveal mechanism of immune regulation in which CTLA-4 acts as an effector molecule to inhibit CD28 costimulation by cell-extrinsic depletion of ligands PMID: 21474713
  44. These results suggest that the polymorphisms of the CD86 gene may be used as genetic markers for making the diagnosis and prognosis of Graves' ophthalmopathy. PMID: 20884055
  45. Thalidomide can up-regulate the expression of B7-1 molecules on myeloma cells. PMID: 20034904
  46. increased CD80 and CD86 expression with the progression of tubulointerstitial lesion might play an important role in the development of lupus nephropathy PMID: 20979791
  47. B7-1 costimulation is required for induction and maintenance of lymphocytic choriomeningitis virus (LCMV)-specific CD8+ T cell memory, in T cell receptor (TCR)transgenic mice. PMID: 20601595
  48. B7-H1 and B7-1 significantly correlated with the pathological grade and tumor-node-metastasis (TNM) stage, respectively in pancreatic cancer. PMID: 20145927
  49. Data show that pollen grains triggered the production of IL-8, TNF-alpha, IL-6 and strongly upregulated the membrane expression of CD80, CD86, CD83, HLA-DR and caused only a slight increase in the expression of CD40. PMID: 20118277
  50. Thus, this study is the first demonstration of a distinct signaling event induced by CD80 and CD86 molecules in B cell lymphoma. PMID: 11726649

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed