Recombinant Human CD84 Protein
Beta LifeScience
SKU/CAT #: BLA-10657P
Recombinant Human CD84 Protein
Beta LifeScience
SKU/CAT #: BLA-10657P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UIB8 |
Synonym | CD_antigen=CD84 CD84 CD84 antigen CD84 molecule CDw84 Cell surface antigen MAX.3 hCD84 Hly9 beta Hly9-beta Leucocyte differentiation antigen CD84 Leukocyte Antigen Leukocyte antigen CD84 Leukocyte differentiation antigen Leukocyte differentiation antigen CD84 LY9B mCD84 Signaling lymphocytic activation molecule 5 SLAF5_HUMAN SLAM family member 5 SLAMF5 |
Description | Recombinant Human CD84 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETA PVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT KRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPL GEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRT HHTG |
Molecular Weight | 24 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured in a cell proliferation assay using PHA stimulated Human T cells in the presence of anti-CD3.The ED50 for this effect is typically 2-6 µg/ml in the presence of anti-CD3 immobilized at 20 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. |