Recombinant Human CD84 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10656P
Recombinant Human CD84 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-10656P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UIB8 |
Synonym | CD_antigen=CD84 CD84 CD84 antigen CD84 molecule CDw84 Cell surface antigen MAX.3 hCD84 Hly9 beta Hly9-beta Leucocyte differentiation antigen CD84 Leukocyte Antigen Leukocyte antigen CD84 Leukocyte differentiation antigen Leukocyte differentiation antigen CD84 LY9B mCD84 Signaling lymphocytic activation molecule 5 SLAF5_HUMAN SLAM family member 5 SLAMF5 |
Description | Recombinant Human CD84 Protein (denatured) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMKDSEIFTVNGILGESVTFPVNIQEP RQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVI SDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVN STCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQ NPVSNNSDSISARQLCADIAMGFRTHHTG |
Molecular Weight | 25 kDa including tags |
Purity | >80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |