Recombinant Human CD89 Protein
Beta LifeScience
SKU/CAT #: BLA-11107P
Recombinant Human CD89 Protein
Beta LifeScience
SKU/CAT #: BLA-11107P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P24071 |
Synonym | CD89 Fc alpha receptor Fc fragment of IgA, receptor for FCAR FCAR_HUMAN IgA Fc receptor Immunoglobulin alpha Fc receptor |
Description | Recombinant Human CD89 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREI GRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTG LYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQS GEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQ DYTTQNVDHHHHHH |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. |