Recombinant Human CD8B Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-11108P
Recombinant Human CD8B Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-11108P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P10966 |
Synonym | CD_antigen=CD8b CD8 antigen 37 kDa chain CD8 antigen, beta chain CD8 antigen, beta polypeptide 1 CD8 antigen, beta polypeptide 1 (p37) CD8B CD8b molecule CD8B1 Flags: Precursor LEU2 LY3 LYT3 MGC119115 OTTHUMP00000160762 OTTHUMP00000160763 OX 8 membrane antigen P37 T cell surface glycoprotein CD8 T cell surface glycoprotein CD8 beta chain T lymphocyte surface glycoprotein beta chain |
Description | Recombinant Human CD8B Protein (denatured) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSLQQTPAYIKVQTNKMVMLSCEAKISLS NMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASR FILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKS TLKKRVCRLPRPETQKGPLCSP |
Molecular Weight | 19 kDa including tags |
Purity | >80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |