Recombinant Human CD90 / Thy1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11113P
Recombinant Human CD90 / Thy1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-11113P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P04216 |
Synonym | CD7 CD90 CD90 antigen CDw90 FLJ33325 MGC128895 T25 Theta antigen Thy 1 Thy 1 cell surface antigen Thy 1 membrane glycoprotein Thy 1 T cell antigen Thy 1.2 Thy-1 antigen Thy-1 membrane glycoprotein Thy1 Thy1 antigen Thy1 T cell antigen Thy1.1 Thy1.2 THY1_HUMAN Thymus cell antigen 1, theta |
Description | Recombinant Human CD90 / Thy1 Protein (Fc Tag) was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGV PEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQN VTVLRDKLVKC |
Molecular Weight | 13 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Binds to Human avβ3 integrin. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |