Recombinant Human CD96 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-10661P

Recombinant Human CD96 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-10661P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P40200-2
Synonym CD96 CD96 molecule Cell surface antigen CD96 DKFZp667E2122 MGC22596 T cell activated increased late expression protein T cell activation, increased late expression T cell surface protein tactile precursor T cell-activated increased late expression protein T-cell surface protein tactile TACT_HUMAN Tactile
Description Recombinant Human CD96 Protein (Fc Tag) was expressed in Mammalian. It is a Protein fragment
Source Mammalian
AA Sequence VWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVY HPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLV LYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKI SSEFTYAWSVEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQ IFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERR FTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVL TRVHSNKPAQSDNLTIWCMALSPVPGNKVWNISSEKITFLLGSEISSTDP PLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSS MTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLHDNVFTSTAR AFSEVPTTANGSTKTNHVHITGIVVNKPKDGMDIEGRMDPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLS LSPGK
Molecular Weight 80 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

Target Details

Target Function May be involved in adhesive interactions of activated T and NK cells during the late phase of the immune response. Promotes NK cell-target adhesion by interacting with PVR present on target cells. May function at a time after T and NK cells have penetrated the endothelium using integrins and selectins, when they are actively engaging diseased cells and moving within areas of inflammation.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References
Associated Diseases C syndrome (CSYN)
Tissue Specificity Expressed on normal T-cell lines and clones, and some transformed T-cells, but no other cultured cell lines tested. It is expressed at very low levels on activated B-cells.

Gene Functions References

  1. Lower CD96 expression was also observed in human IL-9(+) compared with IFN-gamma(+) T cells PMID: 29531070
  2. Blocking CD96 or TIGIT with mAbs has been shown to improve tumor control in mice. PMID: 27620276
  3. CD96 and CD123 are expressed in bone marrow cells of patients with myelodysplastic syndromes PMID: 26642704
  4. In the present study we analyzed the expression of four cell surface antigens relevant to human hematopoiesis-CD90, CD96, CD117, and CD123-in bone marrow from pediatric acute myeloid leukemia patients and normal control subjects. PMID: 24751333
  5. down-regulation of CD96 is an important aspect of HIV-1 pathogenesis and differential expression is related to cell effector functions and HIV-1 disease course. PMID: 23272144
  6. CD96 could serve as a target structure for effector cell-mediated lysis. PMID: 22879978
  7. The positive expression of CD96 on bone marrow hematopoietic stem cells in patients with acute leukemia may be associated with primary drug resistance, relapse and progression. PMID: 21729528
  8. CD96 promotes natural killer (NK) cell adhesion to target cells expressing the poliovirus receptor (PVR), stimulates cytotoxicity of activated NK cells, and mediates acquisition of PVR from target cells. PMID: 15034010
  9. CD96 is a cell surface marker present on many acute myeloid leukemia leukemic stem cells PMID: 17576927
  10. CD96-driven adhesion to CD155 may be crucial in developmental processes PMID: 19056733

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed