Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08411P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08411P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P26441 |
Target Symbol | CNTF |
Synonyms | Ciliary neurotrophic factor; CNTF; CNTF_HUMAN; HCNTF |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN |
Expression Range | 4-196aa |
Protein Length | Partial |
Mol. Weight | 26.1kDa |
Research Area | Developmental Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
Subcellular Location | Cytoplasm. |
Protein Families | CNTF family |
Database References | |
Tissue Specificity | Nervous system. |
Gene Functions References
- Our findings suggest that CNTF over-expression enhances the protective effects of bone marrow mesenchymal stem cells on retinal pigment epithelium cells, thus indicating subretinal-transplantation of CNTF-bone marrow mesenchymal stem cells may be a promising therapy for blue-light -injured retina PMID: 29564604
- Cytokines of the LIF/CNTF family and metabolism PMID: 26817395
- High hydrostatic pressure enables almost 100% refolding of recombinant human ciliary neurotrophic factor from inclusion bodies at high concentration. PMID: 28323167
- CNTFR-specific mutants of CNTF have been developed that bind to the CNTFRalpha-LIFRbeta-gp130 receptor. PMID: 26187860
- Human CNTF expression through lentiviral gene transfer in the rat striatum significantly decreased the levels of neuronal metabolites (N-acetyl-aspartate, N-acetyl-aspartyl-glutamate, and glutamate). PMID: 25833344
- the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first time PMID: 25118897
- R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR. PMID: 24802752
- In this review, CNTF plays an important role in neurogenesis and differentiation of neural stem cells. PMID: 23948898
- The levels of expression and secretion of BDNF and CTNF of induced cells were assessed using immunocytochemical, Real-Time polymerase chain reaction, and enzyme linked immunosorbent assay (ELISA). PMID: 23944834
- CNTF elevated in umbilical cord blood from pre-eclamptic pregnancies PMID: 23654315
- CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Muller glial cells. PMID: 24191003
- Report favourable allelic patterns of ACTN3 and CNTF genes on aerobic performance in athletes. PMID: 23676962
- Data indicate that aspirin increased mRNA and protein expression of CNTF in primary mouse and human astrocytes in a dose- and time-dependent manner. PMID: 23653362
- we show that the release of CNTF by glial cells is a very powerful stimulus for optic fiber regeneration and retinal ganglion cell survival after optic nerve crush PMID: 23194670
- Ciliary neurotrophic factor levels were increased in painful PTT only. PMID: 22337942
- Peptide 6c, corresponding to human CNTF amino acid residues 147-150, induces neurogenesis, neuronal activity and proliferation of immature neurons in the dentate gyrus and improvement of spatial reference memory in mice. PMID: 20952820
- CNTF's effects on retinal pigment epithelial (RPE) physiology PMID: 21912637
- Data show that variants in CNTF were significantly associated with a lower age at onset of the eating disorders. PMID: 20219210
- The role played by CNTF in retinal cell differentiation and survival in retinal progenitors, is reported. PMID: 20428961
- Ciliary neurotrophic factor, and related (CNTF), ligands targeting the established CNTF receptor alpha, binds to sortilin with high affinity. PMID: 20584990
- In women the CNTF polymorphism (odds ratio (OR) = 2.15, 95%CI: 1.27-3.64, p = 0.004) are associated with weight gain. PMID: 19833146
- Studies indicate that leptin, CNTF, LIF and IL-6 present similar three-dimensional fold structure, interact with related class-I receptors and activate similar intracellular pathways. PMID: 19751193
- A null mutation in this protein was evaluated for a relationship to disease susceptibility and disease severity in patients with multiple sclerosis. PMID: 11857064
- Association of a null mutation in the CNTF gene with early onset of multiple sclerosis. PMID: 11890844
- Early onset of severe familial amyotrophic lateral sclerosis with a SOD-1 mutation: potential impact of CNTF as a candidate modifier gene. PMID: 11951178
- CTNF binds to the IL-6 receptor and has a role in neuroprotection PMID: 12643274
- no evidence found to suggest that ciliary neurotrophic factor is involved in the pathogenesis of pelvic endometriosis PMID: 12890930
- Constitutive expression of cytokines in brain induces changes in gene expression characteristic of chronic inflammation leading to either temporal weight reduction (CNTF) or severe cachexia (leukemia inhibitory factor). PMID: 14715713
- Results do not support an effect of the CNTF null allele on body composition, contrary to previous findings. PMID: 14747836
- findings support the hypothesis that CNTF and leptin engage distinct CNS sites and CNTF possesses inflammatory properties distinct from leptin PMID: 15047605
- In spite of axokine gene expression in retinal pigment epithelium, no photoreceptor rescue in retinal degeneration mice. PMID: 15180291
- myogenic lineage-committed human myoblasts can dedifferentiate at a clonal level; CNTF is a novel regulator of skeletal myoblast dedifferentiation via p44/p42 MAPK pathway PMID: 15843428
- CNTF negatively regulates phototransduction, which reduces the photoresponsiveness of rods, resulting in lower electroretinogram amplitudes following light stimulus. PMID: 17192435
- Possible neuroprotective role of CNTF in the optic nerve head. PMID: 17563726
- We conclude that absence of CNTF does not increase susceptibility for neurodegenerative disorders and confirm that it does not affect onset and course of familial and sporadic ALS. PMID: 17651970
- Continuous expression of striatal CNTF at the dose mediated by the expression cassette used in this study was detrimental to transgenic mice with Huntington's disease. PMID: 18293418
- The relative treatment benefit of iloperidone compared with placebo in patients with schizophrenia is enhanced in patients homozygous G/G for the rs1800169 polymorphism of CNTF. PMID: 18303965
- In vivo and in vitro experiments implicate CNTF as an endogenous regulatory component of dopamine D2-receptor-dependent neurogenesis in the subventricular zone and the dentate gyrus of the hippocampus. (Review) PMID: 18524890
- CNTF-mediated signaling is a molecular switch for neuronal versus glial differentiation of retinal stem cells/progenitors. PMID: 18669911
- Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain PMID: 18728012
- PTP-1B constitutes a key divergent element between leptin/insulin and CNTF signaling pathways at the neuronal level. PMID: 19008309
- Certain SNP patterns in VDR and CNTF genes showed better improvement of parameters associated with the effects of low-resistance training using exercise machines as analyzed by comparison between SNP patterns and factor analysis. PMID: 19082510
- The results of this study provided further evidence that the production of ciliary neurotrophic factor by Schwann cells is markedly reduced in Charcot-Marie-Tooth type 1A neuropathy. PMID: 19525893
- Fusion of HIV-1 TAT to CNTF may have modified the CNTF capacity to induce intracellular signaling in hypothalamic neurons. PMID: 19573019
- The CNTF 1357 G --> A polymorphism explains only a small portion of the variability in the muscle strength response to training in women. PMID: 19628720
- An interaction between apoE3 and CNTF occurs with both delipidated apeE3 and apoE3 found within a lipoprotein particle in cerebrospinal fluid. This interaction potentiates the survival-promoting activity of CNTF for hippocampal neurons. PMID: 9236223