Recombinant Human CSF1R Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1238P
Recombinant Human CSF1R Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1238P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P07333 |
Synonym | C FMS CD 115 CD115 CD115 antigen CFMS Colony stimulating factor 1 receptor Colony stimulating factor I receptor CSF 1 R CSF 1R CSF-1 receptor CSF-1-R CSF1 R CSF1R CSF1R_HUMAN CSFR EC 2.7.10.1 FIM 2 FIM2 FMS FMS proto oncogene FMS protooncogene HDLS M-CSF Receptor M-CSF-R Macrophage colony stimulating factor 1 receptor Macrophage colony stimulating factor I receptor Macrophage colony-stimulating factor 1 receptor McDonough feline sarcoma viral (v fms) oncogene homolog MCSFR Oncogen FMS Proto-oncogene c-Fms V-FMS McDonough feline sarcoma viral oncogen homolog, formerly |
Description | Recombinant Human CSF1R Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSIL STNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFE DQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKF IQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEA AQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVD FQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGL NLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLP RLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLC AASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQ SLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDE |
Molecular Weight | 108 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Protein kinase superfamily, Tyr protein kinase family, CSF-1/PDGF receptor subfamily |
Database References | |
Associated Diseases | Leukoencephalopathy, diffuse hereditary, with spheroids (HDLS) |
Tissue Specificity | Expressed in bone marrow and in differentiated blood mononuclear cells. |
Gene Functions References
- M-CSFR inhibition suppressed programmed death-1 and -2 ligand in adult T-cell leukemia/lymphoma (ATLL) cells and macrophages stimulated with conditioned medium from ATL-T cells. PMID: 30541986
- The detection of the CSF1R mutation outside of the region-encoding TKD may extend the genetic spectrum of adult-onset leukoencephalopathy with axonal spheroids and pigmented glia (ALSP) with CSF1R mutations. Mutational analysis of all the coding exons of CSF1R should be considered for patients clinically suspected of having ALSP. PMID: 30136118
- To verify its sensitivity and specificity, we retrospectively applied our criteria to 83 axonal spheroids and pigmented glia cases who had CSF1R mutations PMID: 28921817
- Study find elevated expression of CSF1R in primary gastric cancer tissue (GC) to be significantly associated with the presence of lymph node and peritoneal metastasis, advanced TNM stage, and poor survival. In vitro analysis also revealed a functional role for the CSF1R in GC development, and a prognostic and predictive biomarker for GC. PMID: 29767252
- Adult-onset Mendelian leukodystrophy genes are not common factors implicated in Alzheimer's disease, but there is a potential pathogenic link between NOTCH3, CSF1R, and sporadic late-onset Alzheimer's disease. PMID: 29544907
- Adult-onset leukoencephalopathy with axonal spheroids and pigmented glia.(S39-S41) is a subtype of dominantly inherited leukoencephalopathy caused by CSF1R mutations. PMID: 28827005
- this is the first study to demonstrate CSF1R genetic variant regulates the CSF-1R signaling and sensitivity to CSF-1R inhibitors. PMID: 28724665
- Hypoxia promotes glioma-associated macrophage infiltration via periostin and subsequent M2 polarization by upregulating TGF-beta and M-CSFR. PMID: 27602954
- CSF-1R is a novel therapeutic target. PMID: 27334834
- The phenotype of adult-onset leukoencephalopathy axonal spheroids and pigmented glia caused by CSF1R mutations is affected by sex PMID: 27680516
- CSFIR mutation is associated with Metaplastic Breast Cancer. PMID: 27568101
- Results suggest that TP63 rs7631358 G > A and CSF1R rs10079250 A > G may affect the risk and prognosis of lung cancer in never-smoking females. PMID: 28449811
- findings suggest that expression of wild-type CSF1R in some cells, whether achieved by mosaicism or chimerism, may confer benefit in hereditary diffuse leukoencephalopathy with axonal spheroids. PMID: 27190017
- This review showed that CSF1R mutation is related to Hereditary diffuse leukoencephalopathy with axonal spheroids. PMID: 27338940
- High CSF-1R expression is associated with Clear Cell Renal Cell Carcinoma. PMID: 26467457
- The aim of this study was to compare the expression of CSF-1R in nasopharyngeal carcinoma to nasopharyngitis. PMID: 26743272
- CSF1R mutations account for 10% of idiopathic adult onset leukodystrophies. PMID: 25935893
- The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent PMID: 27239844
- Assessing serum levels of WFA(+) -CSF1R has diagnostic value for predicting carcinogenesis and the survival of LC patients. PMID: 26437001
- CSF1R pathway activation was evident in the cHL and inactivation of this pathway could be a potential therapeutic target in cHL cases. PMID: 26066800
- All 4 hereditary diffuse leukoencephalopathy with axonal spheroids patients had a different single nucleotide mutation in the cytoplasmic part of the gene. Different mutations lead to different levels of depletion of nonclassical slan-positive monocytes. PMID: 26443621
- results suggest that CSF1R SNP rs10079250 may contribute to lung cancer susceptibility in never-smoking females PMID: 25144241
- Report treatment of diffuse-type tenosynovial giant cell tumour of the soft tissue using CSF1R inhibition with emactuzumab. PMID: 26179200
- Autocrine CSF1R signaling is essential in maintaining low claudin expression. PMID: 25088194
- CSF1R gene had variations in genic regions that affected the association of RORalpha with its target binding site in vivo PMID: 25913741
- The first report of hereditary diffuse leukoencephalopathy with neuroaxonal spheroids due to a novel CSF1R missense mutation. PMID: 25012610
- A missense mutation c.2563C>A (p.P855T) of the CSF1R gene has been identified to associated with hereditary diffuse leukoencephalopathy. PMID: 25863088
- CSF-1R D802V and KIT D816V homologous mutations have differential effects on receptor tertiary structure and allosteric communication. PMID: 24828813
- C/EBPalpha-C(m)-mediated downregulation of Csf1r has a negative, rather than positive, impact on the progression of AML involving C/EBPalpha-C(m), which might possibly be accelerated by additional genetic and/or epigenetic alterations inducing Csf1r upregulation PMID: 25534203
- The survival of CSF1R(pos) cells requires active AKT (v-akt murine thymoma viral oncogene homolog 1) signaling, which contributed to increased levels of nuclear, transcriptionally competent beta-catenin. PMID: 24722292
- CSF1R gene analysis was performed in 15 patients with undefined leukoencephalopathy and progressive cognitive decline PMID: 24532199
- We report three patients with HDLS who carried missense mutations in the CSF1R gene, two of them novel (p.L582P and p.V383L). PMID: 24706185
- The identified isoform of CSF-1R mRNA may interfere with the expression of full-length CSF-1R mRNA, thereby affecting the biological activity of the ligand/receptor signaling axis in Sprague-Dawley rats. PMID: 24682770
- CSF-1R mayact as a transcriptional regulator on proliferation-related genes in breast cancer. PMID: 24362524
- Our results provide new insights into the molecular physiology of the CSF-1 receptor and contribute to our understanding of substrate selection by TACE and gamma-secretase. PMID: 24955855
- haploinsufficiency of CSF-1R is sufficient to cause Hereditary diffuse leukoencephalopathy with spheroids [review] PMID: 24807373
- CSF1R mutations in hereditary diffuse leukoencephalopathy with spheroids are loss of function. PMID: 24145216
- diagnosis of HDLS or a de novo mutation in CSF1R must be considered in patients with bilateral symmetric changes in ukodystrophies. PMID: 24034409
- Data indicate that anti-CD115 monoclonal antibody H27K15 exerts partial inhibitory effects on CD115 signaling, but inhibits monocyte chemotactic protein-1 secretion and reduces interleukin-6 production. PMID: 23924795
- Our data demonstrate that a high number of non-Hodgkin/Reed-Sternberg cells expressing CSF-1R are correlated with an increased tumor macrophage content and worse survival in classical Hodgkin lymphoma. PMID: 24619759
- Our report emphasizes the presence of atypical Parkinsonism in Hereditary diffuse leukoencephalopathy with spheroids due to CSF1R mutations PMID: 23787135
- our study indicates that pathogenic mutations in CSF1R are an unlikely cause of multipel sclerosis in the Canadian population PMID: 23889897
- This study showed that a novel A781V mutation in the CSF1R gene causes hereditary diffuse leucoencephalopathy with axonal spheroids. PMID: 23816250
- CSF-1R signaling by haploinsufficiency may play a role in microglial dysfunction leading to the pathogenesis of hereditary diffuse leukoencephalopathy with spheroids PMID: 24336230
- These results indicate that all of the Fms mutations tested severely impair the kinase activity and most of the mutations also impair the trafficking to the cell surface, further suggesting that hereditary diffuse leukoencephalopathy with spheroids is caused by the loss of Fms function. PMID: 24120500
- One mechanism of RANK inhibition by 1,25(OH)2D3 is down-regulation of the M-CSF receptor c-Fms, which is required for the expression of RANK. PMID: 23116709
- Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease. PMID: 23744080
- CSF1R mutations are responsible for a significant proportion of clinically and pathologically proven hereditary diffuse leukoencephalopathies with spheroids. PMID: 23649896
- This study showed that Adult-onset leukoencephalopathy with neuroaxonal spheroids and pigmented glia with CSF1R mutation. PMID: 23052599
- CSF1/CSF1R signaling is important in the recruitment of tumor-infiltrating myeloid cells that can limit the efficacy of radiotherapy PMID: 23418320