Recombinant Human DCL-1 / CD302 Protein
Beta LifeScience
SKU/CAT #: BLA-13299P
Recombinant Human DCL-1 / CD302 Protein
Beta LifeScience
SKU/CAT #: BLA-13299P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8IX05 |
Synonym | BIMLEC C type lectin BIMLEC C type lectin domain family 13 member A C-type lectin BIMLEC C-type lectin domain family 13 member A CD302 CD302 antigen CD302_HUMAN CLEC13A DCL1 KIAA0022 Type I transmembrane C type lectin receptor DCL-1 Type I transmembrane C-type lectin receptor DCL-1 |
Description | Recombinant Human DCL-1 / CD302 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTF DKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRK YLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSP YNEDCVLVVGEENEYPVQFD |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |