Recombinant Human Delta-Like Protein 3 (DLL3) Protein (mFc)
Beta LifeScience
SKU/CAT #: BLC-06198P

Greater than 95% as determined by SDS-PAGE.
Recombinant Human Delta-Like Protein 3 (DLL3) Protein (mFc)
Beta LifeScience
SKU/CAT #: BLC-06198P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Delta-Like Protein 3 (DLL3) Protein (mFc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Activity | Not tested. |
Uniprotkb | Q9NYJ7 |
Target Symbol | DLL3 |
Synonyms | Drosophila Delta homolog 3;Delta3 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-mFc |
Target Protein Sequence | DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Expression Range | 391-492aa |
Protein Length | Partial |
Mol. Weight | 39.7 kDa |
Research Area | Developmental Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Associated Diseases | Spondylocostal dysostosis 1, autosomal recessive (SCDO1) |
Gene Functions References
- these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
- Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
- our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
- The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
- Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
- DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
- We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
- mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
- no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
- The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613