Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His)

Name: Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10863P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P18146
Target Symbol	EGR1
Synonyms	AT225; Early growth response 1; Early growth response protein 1; EGR 1; EGR-1; EGR1; EGR1_HUMAN; G0S30; KROX 24; KROX24; Nerve growth factor-induced clone A; Nerve growth factor-induced protein A; NGFI-A; NGFIA; TIS8; Transcription factor ETR103; Transcription factor Zif268; ZIF 268; ZIF268; Zinc finger protein 225; Zinc finger protein Krox-24; ZNF225
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Expression Range	444-543aa
Protein Length	Partial
Mol. Weight	12.1kDa
Research Area	Transcription
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary. Regulates the amplitude of the expression rhythms of clock genes: ARNTL/BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene ARNTL/BMAL1 in the suprachiasmatic nucleus (SCN).
Subcellular Location	Nucleus. Cytoplasm.
Protein Families	EGR C2H2-type zinc-finger protein family
Database References	HGNC: 3238 OMIM: 128990 KEGG: hsa:1958 STRING: 9606.ENSP00000239938 UniGene: Hs.326035
Tissue Specificity	Detected in neutrophils (at protein level).

Gene Functions References

The differential binding of transcription factor EGR1 to the SNP rs5751348 genomic region with the different genotypes in the A4GALT gene leads to differential activation of P(1) -A4GALT and P(2) -A4GALT expression. PMID: 29399809
High EGR1 expression is associated with thyroid cancer progression. PMID: 30015900
Egr-1 regulates mindin expression by directly binding to the mindin promoter; mindin suppresses colon cancer progression by blocking angiogenesis. PMID: 28991232
The novel EGR1-CCND1 axis contributes to the G1 phase arrest and cell proliferation in glioma PMID: 29246166
we determined that REC8 interacted with EGR1, and inhibited EMT in gastric cancer cells. We thus propose further studies of the pathways associated with REC8 and EGR1 to potentially find novel targets in the treatment for gastric cancer. PMID: 29393474
ATF3 and EGR1 are involved in the beginning of inflammatory processes. Whether these two transcription factors act as tumour suppressors or promoters is context dependent and warrants analysis in further studies PMID: 28803237
Data (including date from studies in knockout mice) suggest that EGR1 is essential in response of airway epithelium to urban pollution/particulate matter (PM); particulate matter induces rapid up-regulation of expression of EGR1 in human bronchial epithelial cells and of Egr1 in mouse lungs. Egr1 knockout mice exhibit significantly reduced airway inflammation and mucus hyper-production in response to PM exposure in vivo. PMID: 29787794
p16 inhibits the tenogenic differentiation oftendon stem/progenitor cells through enhancing the transcription of miR-217 and thereby decreasing the expression of EGR1. PMID: 29036495
Highly expressed Egr-1 may be involved in the recruitment of RNA POL II in GDNF promoter II in a non-binding manner, and thereby involved in regulating GDNF transcription in high-grade glioma cells. PMID: 28187447
SARS coronavirus papain-like protease significantly triggered Egr-1 dependent activation of TGF-beta1 promoter via reactive oxygen species/p38 MAPK/STAT3 pathway. PMID: 27173006
Decreased EGR1 expression is associated with nasopharyngeal carcinoma. PMID: 28269757
results provide new insights into EGR-1/ASPP1 regulatory loop in sensitizing Quercetin-induced apoptosis. EGR-1/ASPP1, therefore, may be potentially used as therapeutic targets to improve cancer's response to pro-apoptosis treatments. PMID: 28594407
Egr-1 upregulation is characteristic of the cardiovascular disease pathogenesis. (Review) PMID: 27251707
aberrant Egr1 expression, which can be suppressed by miR-181a-5p directly, plays a crucial role in the progression of renal Tubulointerstitial fibrosis in diabetic nephropathy. PMID: 28077323
Data suggest the EGR1-miR-30a-5p-NEUROD1 axis might serve as a promising biomarker for diagnosis and treatment monitoring for schizophrenic patients in acute psychotic state. EGR1 and miR-30a-5p were remarkably downregulated, whereas NEUROD1 was significantly upregulated in PBMNCs from patients in acute psychotic state. PMID: 28072411
The Egr-1 is essential for CSE-induced MUC5AC production in HBE cells likely through interaction with and modulation of AP-1, and re-emphasize targeting Egr-1 as a novel therapeutic strategy for COPD. PMID: 28602698
Early growth response (Egr)-1 is essential for fibrotic responses to Transforming growth factor (TGF)-beta. Egr-1 mediates TGF-beta1-induced COL1A1 and COL1A2 mRNA expression and acid-soluble collagen production in buccal mucosal fibroblasts (BMFs).The epigallocatechin-3-gallate (EGCG) can block TGF-beta1-induced collagen production by attenuating Egr-1 expression in BMFs. PMID: 26922429
Along with the reduction of ovarian cancer-2/disabled homolog 2 (DOC-2/DAB2) interactive protein (DAB2IP) expression, EGR-1 gene was upregulated in FI-treated cells. On the other hand, downregulation of EGR-1 gene expression sensitized radioresistant cells to IR accompanied by DAB2IP overexpression and STAT3 inactivation. In addition, NF-kappaB inhibitor, BAY11-7082 enhanced resistant cells' radiosensitivity and chemos... PMID: 27834104
ROS activation of the MAPK (ERK-1/2)/Egr-1 pathway is a main player in the regulatory mechanism for cigarette smoke extract-induced PlGF production. Antioxidants could partly abolish these effects. PMID: 27980400
adipose tissue-derived mesenchymal stem cells (AT-MSCs) from diabetic patients may contribute to microvascular damage and delay wound healing through the overexpression of EGR-1. PMID: 26988763
KLF12 promotes tumor growth by directly activating early growth response protein 1 (EGR1). The levels of KLF12 and EGR1 correlate synergistically with a poor prognosis. These results indicate that KLF12 likely plays an important role in CRC and could serve as a potential prognostic marker and therapeutic target. PMID: 27442508
Shikonin induces apoptosis in some lung cancer cells via activation of FOXO3a/EGR1/SIRT1 signaling, and AKT and p300 negatively regulate this process via Bim upregulation. PMID: 27452907
Inhibition of mTORC1-mediated 4EBP1 phosphorylation leads to decreased expression of c-MYC and subsequent upregulation of the proapoptotic BCL2 family member PUMA, whereas inhibition of mTORC2 results in nuclear factor-kappaB-mediated expression of the Early Growth Response 1 (EGR1) gene, which encodes a transcription factor that binds and transactivates the proapoptotic BCL2L11 locus encoding BIM. PMID: 26917778
Conversely, siRNA-mediated Klotho silencing up-regulated Egr-1, FN, and Col I expression and the p-Smad3/Smad3 ratio. Moreover, the effects of si-Klotho on Egr-1 expression were abolished by the TGF-beta1 inhibitor SB-431542. Klotho overexpression can prevent mesangial ECM production in high-glucose-treated human MCs, an effect that has been partially attributed to Egr-1 down-regulation facilitated by TGF-beta1/Smad3 s... PMID: 28411025
ZHX1 was found to play essential roles in the proliferation, migration, and invasion of cholangiocarcinoma cells, and its effect on the proliferation was mediated partially through EGR1. PMID: 27835650
Data show the correlation between the measured and predicted binding free energy values for Egr-1-DNA binding. PMID: 27933778
SphK1 is regulated by PDGF-BB in pulmonary artery smooth muscle cells via the transcription factor Egr-1, promoting cell proliferation. PMID: 27099350
miR124 prevents tendon differentiation via suppressing egr1 expression. PMID: 27569005
we propose a model whereby high YB-1 levels in some TNBC cells can lead to reduced levels of EGR1, which in turn promotes slow cell cycling and resistance to PTX. Therefore YB-1 and EGR1 levels are biologically linked and may provide a biomarker for TNBC response to PTX. PMID: 27072400
TRAIL overexpression was co-regulated by Egr1 and Hypoxia response element. TRAIL might promote hypoxic A549 cell radiosensitivity and induce apoptosis depending on DR5 to caspase-3 pathways. PMID: 27878298
These results suggest that frameshift mutations of EGR1 and BRSK1 might play a role in tumorigenesis through tumor suppressor gene inactivation in colorectal cancer and gastric cancer. PMID: 27677186
Pulmonary vascular Egr-1 expression is significantly increased in patients with PAH, appears specifically associated with neointimal-type vascular remodeling, and correlates with disease progression. PMID: 26774383
GRK2 may inhibit IGF1-induced human hepatocellular carcinoma cell growth and migration through downregulation of EGR1. PMID: 26936374
did not find positive association signals of the four single nucleotide polymorphisms in the LAMA2 and EGR1 genes with high myopia PMID: 26984843
In nucleus pulposus cells early transcriptional programming initiated by EGR1 is essentially restrained by the cells' epigenome as it was determined during development and differentiation. PMID: 26975996
in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop. PMID: 27002148
The Egr-1 and Atg16L1 genes' polymorphisms were significant risk factors for susceptibility to chronic obstructive pulmonary disease (COPD) . These results demonstrate that autophagy regulator genetic mutations are associated with COPD in male smokers. PMID: 24012056
IL-33-ERK/JNK/p38/Egr-1/TSLP axis involved in allergic skin Th2 inflammation PMID: 26120956
EGR-1 overexpression in Jurkat cells transfected to express Tax, promoted the activation of several genes, especially those that contained AP-1 (Jun/c-Fos), but knockdown of endogenous EGR-1 by siRNA reduced Tax-mediated JNK-1 transcription. PMID: 26573109
EGR-1 plays a critical role in LTD4-induced cytokine transcription in Hodgkin cell lines PMID: 26115646
Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines. PMID: 26498686
C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a. PMID: 26720342
mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes PMID: 26538827
Egr1 depletion delayed the growth of heterotopically implanted GL261 and HCT116 tumors. PMID: 26206332
H/R activates ROS/Egr-1 signaling pathway in H9c2 cells, and JNK activation plays an important role in this pathway PMID: 26134032
Functional changes of EGR1 (and miR-132) during the course of Alzheimer's disease contribute to late neurodegeneration in the nucleus basalis of Meynert. PMID: 26792551
Data show that that the nanopore can detect and discriminate both specific and nonspecific binding conformations of early growth response 1 protein zif268 on DNA. PMID: 26109509
Results indicate that EGR-1 is a transcriptional regulator of MTCH1 and give some clues about the cellular processes in which MTCH1 might participate. PMID: 26692143
An important new role of EGR1 in viral infection provide new insight into the novel mechanism underlying the regulation of EV71 replication. PMID: 25724735
delta-tocotrienol-induced apoptosis in pancreatic cancer cells to EGR-1 regulation of Bax expression. Forced expression of EGR-1 induces Bax expression and apoptosis in pancreatic cancer cells. PMID: 25997867

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.