Recombinant Human EBI3 Protein (Complex)
Beta LifeScience
SKU/CAT #: BLA-0210P
Recombinant Human EBI3 Protein (Complex)
Beta LifeScience
SKU/CAT #: BLA-0210P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q14213NP_000873.2 |
Synonym | cytokine receptor EBI3 EBV induced gene 3 protein EBV-induced gene 3 protein Epstein Barr virus induced 3 Epstein Barr virus induced gene 3 Epstein Barr virus induced gene 3 protein Epstein-Barr virus-induced gene 3 protein IL 27 subunit beta IL 27B IL-27 subunit beta IL-27B IL27 subunit IL27 subunit beta IL27B IL27B_HUMAN IL35 subunit interleukin 27 subunit beta Interleukin-27 subunit beta |
Description | Recombinant Human EBI3 Protein (Complex) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGM AARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYK RQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLP ATATMSLGK |
Molecular Weight | 23 kDa |
Purity | >= 98% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Bioactivity was measured in a cell proliferation assay using anti-CD3 activated Human peripheral mononuclear cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |