Recombinant Human EGFL8 Protein
Beta LifeScience
SKU/CAT #: BLA-1261P
Recombinant Human EGFL8 Protein
Beta LifeScience
SKU/CAT #: BLA-1261P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C6orf8 EGF like domain containing protein 8 precursor EGF like domain multiple 8 Epidermal growth factor like protein 8 FLJ44493 MGC44938 MGC59719 Multiple EGF like domain protein 8 NG3 NG3 protein OTTHUMP00000062670 Vascular endothelial statin 2 VE statin 2 |
Description | Recombinant Human EGFL8 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYN ESYSQPVYKPYLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGW KKRHPGALTCEAICAKPCLNGGVCVRPDQCECAPGWGGKHCHVDVDECRT SITLCSHHCFNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVA VREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVLPVPPEELQPE QVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNHR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |