Recombinant Human FGF12 Protein
Beta LifeScience
SKU/CAT #: BLA-1381P
Recombinant Human FGF12 Protein
Beta LifeScience
SKU/CAT #: BLA-1381P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P61328-2 |
Synonym | EIEE47 FGF-12 Fgf12 FGF12_HUMAN FGF12B FHF-1 FHF1 Fibroblast growth factor 12 Fibroblast growth factor 12B Fibroblast growth factor FGF 12b Fibroblast growth factor homologous factor 1 Myocyte activating factor Myocyte-activating factor |
Description | Recombinant Human FGF12 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVG LRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSST LYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQS LHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
Molecular Weight | 21 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |