Recombinant Human FGF22 Protein
Beta LifeScience
SKU/CAT #: BLA-1423P
Recombinant Human FGF22 Protein
Beta LifeScience
SKU/CAT #: BLA-1423P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9HCT0 |
Synonym | FGF 22 FGF-22 FGF22 FGF22_HUMAN Fibroblast growth factor 22 |
Description | Recombinant Human FGF22 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQD SILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEE NGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS |
Molecular Weight | 17 kDa |
Purity | >= 95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |
Target Details
Target Function | Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References |
Gene Functions References
- This study showed that serum FGF22 levels in depressive patients were negatively correlated with serum IL-1beta levels. In animal and cell experiments, enhancing the levels of FGF22 in rat hippocampus was demonstrated to alleviate the chronic unpredictable mild stress-induced depression. The increase in FGF22 was found to be associated with reduced IL-1beta expression and hippocampal apoptosis. PMID: 28948716