Recombinant Human FGF6 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1436P
Recombinant Human FGF6 Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1436P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P10767 |
Synonym | FGF 6 FGF-6 Fgf6 FGF6_HUMAN Fibroblast growth factor 6 Fibroblast growth factor 6 precursor HBGF 6 HBGF-6 HBGF6 Heparin secretory-transforming protein 2 Heparin-binding growth factor 6 HST 2 HST-2 HST2 HSTF-2 |
Description | Recombinant Human FGF6 Protein (Animal Free) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLY CNVGIGFHLQVLPDGRISGTHEENPYSLLEISTVERGVVSLFGVRSALFV AMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRV KRGSKVSPIMTVTHFLPRI |
Molecular Weight | 19 kDa |
Purity | >= 95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Proliferation of NR6R-3T3 cells with 1μg heparin:-‰¤1 ng/ml; -‰¥ 1.0 x 106 units/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |