Recombinant Human FGFBP2 Protein
Beta LifeScience
SKU/CAT #: BLA-1451P
Recombinant Human FGFBP2 Protein
Beta LifeScience
SKU/CAT #: BLA-1451P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 37 kDa killer-specific secretory protein FGF-binding protein 2 FGF-BP2 FGFBP-2 FGFBP2 FGFP2_HUMAN Fibroblast growth factor-binding protein 2 HBp17-related protein HBp17-RP Ksp37 |
Description | Recombinant Human FGFBP2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSL GQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELR RLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSL RPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKK KAWEHCWKPFQALCAFLISFFRG |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |